(data stored in ACNUC13479 zone)

EMBL: CP002688.PE169

CP002688.PE169       Location/Qualifiers
FT   CDS             join(337234..337574,337669..337678)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.140"
FT                   /gene_synonym="T20L15_140"
FT                   /locus_tag="AT5G01870"
FT                   /product="Bifunctional inhibitor/lipid-transfer
FT                   protein/seed storage 2S albumin superfamily protein"
FT                   /note="Bifunctional inhibitor/lipid-transfer protein/seed
FT                   storage 2S albumin superfamily protein; FUNCTIONS IN: lipid
FT                   binding; INVOLVED IN: lipid transport; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 15 plant structures;
FT                   EXPRESSED DURING: 7 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Bifunctional inhibitor/plant lipid transfer
FT                   protein/seed storage (InterPro:IPR016140), Plant lipid
FT                   transfer protein/seed storage/trypsin-alpha amylase
FT                   inhibitor (InterPro:IPR003612), Plant lipid transfer
FT                   protein/Par allergen (InterPro:IPR000528), Plant lipid
FT                   transfer protein/hydrophobic protein, helical domain
FT                   (InterPro:IPR013770); BEST Arabidopsis thaliana protein
FT                   match is: lipid transfer protein 6 (TAIR:AT3G08770.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZV9"
FT                   /db_xref="InterPro:IPR000528"
FT                   /db_xref="InterPro:IPR016140"
FT                   /db_xref="InterPro:IPR036312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP587064.1,INSD:AI998609.1,INSD:BP593031.1,
FT                   INSD:AA597869.1,INSD:BP857534.1,INSD:EL976573.1,
FT                   INSD:BP625831.1,INSD:CB253232.1,INSD:AU235904.1,
FT                   INSD:AA650642.1,INSD:EL034220.1,INSD:BP635731.1,
FT                   INSD:BP595196.1,INSD:BP576943.1,INSD:ES174257.1,
FT                   INSD:BP565153.1,INSD:BP636339.1,INSD:ES145400.1,
FT                   INSD:ES050770.1,INSD:ES073859.1,INSD:BP584949.1,
FT                   INSD:EG466378.1,INSD:ES079750.1,INSD:BP575437.1,
FT                   INSD:BP865464.1,INSD:BP623814.1,INSD:AU226677.1,
FT                   INSD:BP636021.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK227988.1,INSD:BX833231.1,INSD:BX832243.1"
FT                   /protein_id="AED90403.1"
FT                   /translation="MMRVVLPLCLLLASIFAWGSEAAISCNAVQANLYPCVVYVVQGGA
FT                   IPYSCCNGIRMLSKQATSASDKQGVCRCIKSVVGRVSYSSIYLKKAAALPGKCGVKLPY
FT                   KIDPSTNCNSIK"
     MMRVVLPLCL LLASIFAWGS EAAISCNAVQ ANLYPCVVYV VQGGAIPYSC CNGIRMLSKQ        60
     ATSASDKQGV CRCIKSVVGR VSYSSIYLKK AAALPGKCGV KLPYKIDPST NCNSIK           116
//

If you have problems or comments...

PBIL Back to PBIL home page