(data stored in ACNUC13479 zone)

EMBL: CP002688.PE17

CP002688.PE17        Location/Qualifiers
FT   CDS             join(23175..23271,23359..23492,23580..23771,23858..24079,
FT                   24181..24336,24412..24525,24617..24847)
FT                   /codon_start=1
FT                   /gene="BSK10"
FT                   /gene_synonym="brassinosteroid-signaling kinase 10"
FT                   /gene_synonym="F7J8.40"
FT                   /gene_synonym="F7J8_40"
FT                   /locus_tag="AT5G01060"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01060"
FT                   /db_xref="GOA:A0A1P8BE40"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BE40"
FT                   /protein_id="ANM69868.1"
FT                   /translation="MANLIGCCCDDNERLLVAEYMPNGTLAKHLFHWEKRPMKWEMRLK
FT                   VALHTARALEYCNDKGIDLYHDLNPYRIMFDKTGIPKLSCFGLMKNSHEGKIYSTNLAF
FT                   APPEYLRLGTVIAESVTFSFGTLLLDLMSGRHIPPNHALDLFRGKNYLVLMDSALDGQF
FT                   SDEDRTELIHVASRCFKTEPEERPSIKFLKATLSRLQKRAKLCPINVKRPMSPPSKNLP
FT                   EKTKPATESLKLTPFGDACSRADLSSIHELLEKLGYEEDNGVGNEFSFQMWTGEMQENM
FT                   DYKKHGDAAFLAKDFDTAIEFYTEFMTGAPTVSPTVLARRCLCYLMTEMFSEALSDAMQ
FT                   AQVASPEWPIPLYLQAACLFKLEMEAEAKEALRHGSALEAY"
     MANLIGCCCD DNERLLVAEY MPNGTLAKHL FHWEKRPMKW EMRLKVALHT ARALEYCNDK        60
     GIDLYHDLNP YRIMFDKTGI PKLSCFGLMK NSHEGKIYST NLAFAPPEYL RLGTVIAESV       120
     TFSFGTLLLD LMSGRHIPPN HALDLFRGKN YLVLMDSALD GQFSDEDRTE LIHVASRCFK       180
     TEPEERPSIK FLKATLSRLQ KRAKLCPINV KRPMSPPSKN LPEKTKPATE SLKLTPFGDA       240
     CSRADLSSIH ELLEKLGYEE DNGVGNEFSF QMWTGEMQEN MDYKKHGDAA FLAKDFDTAI       300
     EFYTEFMTGA PTVSPTVLAR RCLCYLMTEM FSEALSDAMQ AQVASPEWPI PLYLQAACLF       360
     KLEMEAEAKE ALRHGSALEA Y                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page