(data stored in ACNUC13479 zone)

EMBL: CP002688.PE170

CP002688.PE170       Location/Qualifiers
FT   CDS             339017..339496
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.150"
FT                   /gene_synonym="T20L15_150"
FT                   /gene_synonym="DAF-Like gene 2"
FT                   /gene_synonym="DAFL2"
FT                   /locus_tag="AT5G01880"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; EXPRESSED IN: 10 plant structures; EXPRESSED
FT                   DURING: LP.04 four leaves visible, 4 anthesis, C globular
FT                   stage, petal differentiation and expansion stage; CONTAINS
FT                   InterPro DOMAIN/s: Zinc finger, RING-type
FT                   (InterPro:IPR001841), Zinc finger, C3HC4 RING-type
FT                   (InterPro:IPR018957); BEST Arabidopsis thaliana protein
FT                   match is: RING/U-box superfamily protein
FT                   (TAIR:AT3G10910.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZV8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH928766.1,INSD:EG479466.1,INSD:EG479459.1,
FT                   INSD:EG479471.1,INSD:EG419709.1,INSD:Z34026.1,
FT                   INSD:EG479456.1,INSD:EG478682.1,INSD:EG478698.1,
FT                   INSD:EG479462.1,INSD:EG479465.1,INSD:EG479457.1,
FT                   INSD:EG479461.1,INSD:EH917560.1,INSD:EG478683.1,
FT                   INSD:EL158103.1,INSD:EG479455.1,INSD:BP655144.1,
FT                   INSD:EG479472.1,INSD:EH960988.1,INSD:EG478696.1,
FT                   INSD:EG478680.1,INSD:EG478694.1,INSD:EG479458.1,
FT                   INSD:EG478699.1,INSD:CB258748.1,INSD:BP641836.1,
FT                   INSD:EG479470.1,INSD:EG478689.1,INSD:EG479474.1,
FT                   INSD:EG478681.1,INSD:EG478687.1,INSD:EG479467.1,
FT                   INSD:ES093711.1,INSD:EG479469.1,INSD:BP612083.1,
FT                   INSD:EG478692.1,INSD:AU228792.1,INSD:EG478677.1,
FT                   INSD:EG478690.1,INSD:EG479468.1,INSD:EG478691.1,
FT                   INSD:EG479463.1,INSD:BP660370.1,INSD:EG478695.1,
FT                   INSD:EG478684.1,INSD:BP655253.1,INSD:AU237707.1,
FT                   INSD:EG478685.1,INSD:EL251213.1,INSD:BP833856.1,
FT                   INSD:EL249069.1,INSD:EG479454.1,INSD:EG478688.1,
FT                   INSD:ES137740.1,INSD:EL072657.1,INSD:EG478676.1,
FT                   INSD:BP623598.1,INSD:EG479460.1,INSD:BP629875.1,
FT                   INSD:EG479473.1,INSD:EG479476.1,INSD:BP651369.1,
FT                   INSD:EG478693.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK229217.1,INSD:BX830343.1,INSD:BX833914.1,
FT                   INSD:BX833639.1,INSD:BT010973.1,INSD:EF182905.1,
FT                   INSD:BT010682.1"
FT                   /protein_id="AED90404.1"
FT                   /translation="MHRLLLESHGGGNETSGSGGGDGYTRDMNFDANMVIILAALLCAL
FT                   ILALGLNSILRCAMRCGFGLSSSAAAGTVADRAGLKKRELKKFPVAEYGSGEVKIAATE
FT                   CAICLGEFADGERVRVLPPCNHSFHMSCIDTWLVSHSSCPNCRHSLIEVHVAGSE"
     MHRLLLESHG GGNETSGSGG GDGYTRDMNF DANMVIILAA LLCALILALG LNSILRCAMR        60
     CGFGLSSSAA AGTVADRAGL KKRELKKFPV AEYGSGEVKI AATECAICLG EFADGERVRV       120
     LPPCNHSFHM SCIDTWLVSH SSCPNCRHSL IEVHVAGSE                              159
//

If you have problems or comments...

PBIL Back to PBIL home page