(data stored in ACNUC13479 zone)

EMBL: CP002688.PE171

CP002688.PE171       Location/Qualifiers
FT   CDS             339838..340266
FT                   /codon_start=1
FT                   /locus_tag="AT5G01881"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; Has 3 Blast hits to 3 proteins in 2
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 3; Viruses - 0; Other Eukaryotes - 0 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01881.1"
FT                   /db_xref="GOA:Q2V3A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V3A8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG479467.1,INSD:EG478687.1,INSD:EH928766.1,
FT                   INSD:EG479469.1,INSD:EG479466.1,INSD:EG478692.1,
FT                   INSD:EG479459.1,INSD:EG479471.1,INSD:EG478677.1,
FT                   INSD:EG419709.1,INSD:EG478690.1,INSD:EG479468.1,
FT                   INSD:EG479456.1,INSD:EG478682.1,INSD:EG479463.1,
FT                   INSD:EG478691.1,INSD:EG478695.1,INSD:EG478684.1,
FT                   INSD:EG478685.1,INSD:EG479465.1,INSD:EG479462.1,
FT                   INSD:EG478698.1,INSD:EG479454.1,INSD:EG479457.1,
FT                   INSD:EG478688.1,INSD:EG479461.1,INSD:EG478683.1,
FT                   INSD:EL158103.1,INSD:EG479455.1,INSD:EG479472.1,
FT                   INSD:EH960988.1,INSD:EG478696.1,INSD:EL072657.1,
FT                   INSD:EG478680.1,INSD:EG478694.1,INSD:EG478676.1,
FT                   INSD:EG479458.1,INSD:EG478699.1,INSD:EG479460.1,
FT                   INSD:EG479470.1,INSD:EG479473.1,INSD:EG479476.1,
FT                   INSD:EG479474.1,INSD:EG478689.1,INSD:EG478693.1,
FT                   INSD:EG478681.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:EF182905.1,INSD:BX830343.1"
FT                   /protein_id="AED90405.1"
FT                   /translation="MSEEEEEEQRRRLGVGVVWKLKVCVRAKGFSLKLNIRNKLSLHRW
FT                   SILLRFRKHHHHLKSKPSDWVRFRRSLFALFRGRKQREVDTKKKLIKLVRNRAVVVAKK
FT                   AKGVGVVVTLIIVVINFLVPWINKLSSELDCYELFGIK"
     MSEEEEEEQR RRLGVGVVWK LKVCVRAKGF SLKLNIRNKL SLHRWSILLR FRKHHHHLKS        60
     KPSDWVRFRR SLFALFRGRK QREVDTKKKL IKLVRNRAVV VAKKAKGVGV VVTLIIVVIN       120
     FLVPWINKLS SELDCYELFG IK                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page