(data stored in ACNUC13479 zone)

EMBL: CP002688.PE172

CP002688.PE172       Location/Qualifiers
FT   CDS             complement(join(341661..343107,343194..344650))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.160"
FT                   /gene_synonym="T20L15_160"
FT                   /gene_synonym="PXC2"
FT                   /gene_synonym="PXY/TDR-correlated 2"
FT                   /locus_tag="AT5G01890"
FT                   /product="Leucine-rich receptor-like protein kinase family
FT                   protein"
FT                   /note="Leucine-rich receptor-like protein kinase family
FT                   protein; FUNCTIONS IN: protein serine/threonine kinase
FT                   activity, kinase activity, ATP binding; INVOLVED IN:
FT                   transmembrane receptor protein tyrosine kinase signaling
FT                   pathway, protein amino acid phosphorylation; LOCATED IN:
FT                   plasma membrane; EXPRESSED IN: 22 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Leucine-rich repeat-containing
FT                   N-terminal domain, type 2 (InterPro:IPR013210),
FT                   Leucine-rich repeat (InterPro:IPR001611),
FT                   Serine-threonine/tyrosine-protein kinase
FT                   (InterPro:IPR001245), Protein kinase-like domain
FT                   (InterPro:IPR011009); BEST Arabidopsis thaliana protein
FT                   match is: Leucine-rich repeat protein kinase family protein
FT                   (TAIR:AT3G56370.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01890"
FT                   /db_xref="GOA:Q9LZV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP591269.1,INSD:DR362258.1,INSD:AV545971.1,
FT                   INSD:AV546670.1,INSD:EH833919.1,INSD:AV550395.1,
FT                   INSD:BP603095.1,INSD:EL019187.1,INSD:EL256797.1,
FT                   INSD:BP798200.1,INSD:EL226709.1,INSD:EL172632.1,
FT                   INSD:EL031685.1,INSD:BP598389.1,INSD:AV530444.1,
FT                   INSD:AV553714.1,INSD:EG519415.1,INSD:BP606476.1,
FT                   INSD:AV532756.1,INSD:AV824587.1,INSD:EL031903.1,
FT                   INSD:BP601690.1,INSD:EH897067.1,INSD:DR362259.1,
FT                   INSD:AV554791.1,INSD:AV546291.1,INSD:AV522783.1,
FT                   INSD:EG519416.1,INSD:AV548793.1,INSD:AV786807.1,
FT                   INSD:EL106101.1,INSD:BP609202.1,INSD:AV548219.1,
FT                   INSD:EG422692.1,INSD:BP612496.1,INSD:AV547112.1,
FT                   INSD:AV545809.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF424563.1,INSD:BT004520.1"
FT                   /protein_id="AED90406.1"
FT                   /translation="MFNGAVSLLFLFLAVVSARADPTFNDDVLGLIVFKAGLDDPLSKL
FT                   SSWNSEDYDPCNWVGCTCDPATNRVSELRLDAFSLSGHIGRGLLRLQFLHTLVLSNNNL
FT                   TGTLNPEFPHLGSLQVVDFSGNNLSGRIPDGFFEQCGSLRSVSLANNKLTGSIPVSLSY
FT                   CSTLTHLNLSSNQLSGRLPRDIWFLKSLKSLDFSHNFLQGDIPDGLGGLYDLRHINLSR
FT                   NWFSGDVPSDIGRCSSLKSLDLSENYFSGNLPDSMKSLGSCSSIRLRGNSLIGEIPDWI
FT                   GDIATLEILDLSANNFTGTVPFSLGNLEFLKDLNLSANMLAGELPQTLSNCSNLISIDV
FT                   SKNSFTGDVLKWMFTGNSESSSLSRFSLHKRSGNDTIMPIVGFLQGLRVLDLSSNGFTG
FT                   ELPSNIWILTSLLQLNMSTNSLFGSIPTGIGGLKVAEILDLSSNLLNGTLPSEIGGAVS
FT                   LKQLHLHRNRLSGQIPAKISNCSALNTINLSENELSGAIPGSIGSLSNLEYIDLSRNNL
FT                   SGSLPKEIEKLSHLLTFNISHNNITGELPAGGFFNTIPLSAVTGNPSLCGSVVNRSCLS
FT                   VHPKPIVLNPNSSNPTNGPALTGQIRKSVLSISALIAIGAAAVIAIGVVAVTLLNVHAR
FT                   SSVSRHDAAAALALSVGETFSCSPSKDQEFGKLVMFSGEVDVFDTTGADALLNKDSELG
FT                   RGGFGVVYKTSLQDGRPVAVKKLTVSGLIKSQEEFEREMRKLGKLRHKNVVEIKGYYWT
FT                   QSLQLLIHEFVSGGSLYRHLHGDESVCLTWRQRFSIILGIARGLAFLHSSNITHYNMKA
FT                   TNVLIDAAGEAKVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDRCDV
FT                   YGFGILVLEVVTGKRPVEYAEDDVVVLCETVREGLEEGRVEECVDPRLRGNFPAEEAIP
FT                   VIKLGLVCGSQVPSNRPEMEEVVKILELIQCPSHDLE"
     MFNGAVSLLF LFLAVVSARA DPTFNDDVLG LIVFKAGLDD PLSKLSSWNS EDYDPCNWVG        60
     CTCDPATNRV SELRLDAFSL SGHIGRGLLR LQFLHTLVLS NNNLTGTLNP EFPHLGSLQV       120
     VDFSGNNLSG RIPDGFFEQC GSLRSVSLAN NKLTGSIPVS LSYCSTLTHL NLSSNQLSGR       180
     LPRDIWFLKS LKSLDFSHNF LQGDIPDGLG GLYDLRHINL SRNWFSGDVP SDIGRCSSLK       240
     SLDLSENYFS GNLPDSMKSL GSCSSIRLRG NSLIGEIPDW IGDIATLEIL DLSANNFTGT       300
     VPFSLGNLEF LKDLNLSANM LAGELPQTLS NCSNLISIDV SKNSFTGDVL KWMFTGNSES       360
     SSLSRFSLHK RSGNDTIMPI VGFLQGLRVL DLSSNGFTGE LPSNIWILTS LLQLNMSTNS       420
     LFGSIPTGIG GLKVAEILDL SSNLLNGTLP SEIGGAVSLK QLHLHRNRLS GQIPAKISNC       480
     SALNTINLSE NELSGAIPGS IGSLSNLEYI DLSRNNLSGS LPKEIEKLSH LLTFNISHNN       540
     ITGELPAGGF FNTIPLSAVT GNPSLCGSVV NRSCLSVHPK PIVLNPNSSN PTNGPALTGQ       600
     IRKSVLSISA LIAIGAAAVI AIGVVAVTLL NVHARSSVSR HDAAAALALS VGETFSCSPS       660
     KDQEFGKLVM FSGEVDVFDT TGADALLNKD SELGRGGFGV VYKTSLQDGR PVAVKKLTVS       720
     GLIKSQEEFE REMRKLGKLR HKNVVEIKGY YWTQSLQLLI HEFVSGGSLY RHLHGDESVC       780
     LTWRQRFSII LGIARGLAFL HSSNITHYNM KATNVLIDAA GEAKVSDFGL ARLLASALDR       840
     CVLSGKVQSA LGYTAPEFAC RTVKITDRCD VYGFGILVLE VVTGKRPVEY AEDDVVVLCE       900
     TVREGLEEGR VEECVDPRLR GNFPAEEAIP VIKLGLVCGS QVPSNRPEME EVVKILELIQ       960
     CPSHDLE                                                                 967
//

If you have problems or comments...

PBIL Back to PBIL home page