(data stored in ACNUC13479 zone)

EMBL: CP002688.PE173

CP002688.PE173       Location/Qualifiers
FT   CDS             343365..343910
FT                   /codon_start=1
FT                   /locus_tag="AT5G01895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BBA6"
FT                   /protein_id="ANM68878.1"
FT                   /translation="MPVGMEPKRELVDILSCNKLVRIQMLDGNSPVKPFEDRSRTRRPW
FT                   RNPTMGIMVSFPDLLWRLNLESEELSEFPVNIHLSTSPVNEFLLTSMEIRLEQLERVCG
FT                   SSPASMFADRLRSFKNSRFPRENGTVPVKLLAERSRISRVAMSPIQSGISPIREFPRRR
FT                   MELQEPRLFIESGRFPEK"
     MPVGMEPKRE LVDILSCNKL VRIQMLDGNS PVKPFEDRSR TRRPWRNPTM GIMVSFPDLL        60
     WRLNLESEEL SEFPVNIHLS TSPVNEFLLT SMEIRLEQLE RVCGSSPASM FADRLRSFKN       120
     SRFPRENGTV PVKLLAERSR ISRVAMSPIQ SGISPIREFP RRRMELQEPR LFIESGRFPE       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page