(data stored in ACNUC13479 zone)

EMBL: CP002688.PE175

CP002688.PE175       Location/Qualifiers
FT   CDS             complement(join(357950..358084,358164..358229,
FT                   358314..358655))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.180"
FT                   /gene_synonym="T20L15_180"
FT                   /locus_tag="AT5G01910"
FT                   /product="myelin transcription factor"
FT                   /note="unknown protein; Has 66 Blast hits to 66 proteins in
FT                   27 species: Archae - 0; Bacteria - 2; Metazoa - 18; Fungi -
FT                   7; Plants - 29; Viruses - 0; Other Eukaryotes - 10 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01910"
FT                   /db_xref="GOA:Q1PE06"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PE06"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG525076.1,INSD:EG525064.1,INSD:EG525071.1,
FT                   INSD:EG525077.1,INSD:EG525081.1,INSD:EG525066.1,
FT                   INSD:EG525059.1,INSD:EG525083.1,INSD:EG525080.1,
FT                   INSD:EG525065.1,INSD:EG525079.1,INSD:EG525063.1,
FT                   INSD:EG525060.1,INSD:ES029881.1,INSD:EG421639.1,
FT                   INSD:EL255089.1,INSD:EG525082.1,INSD:EG525069.1,
FT                   INSD:EG421638.1,INSD:ES020167.1,INSD:EG525084.1,
FT                   INSD:EG525073.1,INSD:EG421636.1,INSD:EL170641.1,
FT                   INSD:EG421637.1,INSD:EG525068.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ653260.1,INSD:DQ446912.1"
FT                   /protein_id="AED90408.1"
FT                   /translation="MKCSGRKALQPRNIYQTPKEDAFFVKPKAAEKLKENLNLETSIDA
FT                   SLAEELSAFKKKLERLREDRESTEKLLKERDEAMDLHMSHLLQRGETQKSLEIQVDRLF
FT                   RLKELHAYSSKISPIRSLRAKEQQEKMRRFTFAGEEQPDEESSVEIANGPIEEESSTKS
FT                   NVLERDMIIANTQPIIS"
     MKCSGRKALQ PRNIYQTPKE DAFFVKPKAA EKLKENLNLE TSIDASLAEE LSAFKKKLER        60
     LREDRESTEK LLKERDEAMD LHMSHLLQRG ETQKSLEIQV DRLFRLKELH AYSSKISPIR       120
     SLRAKEQQEK MRRFTFAGEE QPDEESSVEI ANGPIEEESS TKSNVLERDM IIANTQPIIS       180
//

If you have problems or comments...

PBIL Back to PBIL home page