(data stored in ACNUC13479 zone)

EMBL: CP002688.PE176

CP002688.PE176       Location/Qualifiers
FT   CDS             complement(join(358077..358229,358314..358655))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.180"
FT                   /gene_synonym="T20L15_180"
FT                   /locus_tag="AT5G01910"
FT                   /product="myelin transcription factor"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; EXPRESSED
FT                   IN: 16 plant structures; EXPRESSED DURING: 11 growth
FT                   stages; Has 30201 Blast hits to 17322 proteins in 780
FT                   species: Archae - 12; Bacteria - 1396; Metazoa - 17338;
FT                   Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes
FT                   - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01910"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01910.2"
FT                   /db_xref="GOA:B3H7E6"
FT                   /db_xref="UniProtKB/TrEMBL:B3H7E6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG525084.1,INSD:EG525074.1,INSD:EL255089.1,
FT                   INSD:EG525075.1,INSD:ES029881.1,INSD:ES020167.1"
FT                   /protein_id="AED90409.1"
FT                   /translation="MKCSGRKALQPRNIYQTPKEDAFFVKPKAAEKLKENLNLETSIDA
FT                   SLAEELSAFKKKLERLREDRESTEKLLKERDEAMDLHMSHLLQRGETQKSLEIQVDRLF
FT                   RLKELHAYSSKISPIRSLRAKEQQEKMRRFTFVINVSTLLSLSFFLPIHLWVFSRPFSG
FT                   R"
     MKCSGRKALQ PRNIYQTPKE DAFFVKPKAA EKLKENLNLE TSIDASLAEE LSAFKKKLER        60
     LREDRESTEK LLKERDEAMD LHMSHLLQRG ETQKSLEIQV DRLFRLKELH AYSSKISPIR       120
     SLRAKEQQEK MRRFTFVINV STLLSLSFFL PIHLWVFSRP FSGR                        164
//

If you have problems or comments...

PBIL Back to PBIL home page