(data stored in ACNUC13479 zone)

EMBL: CP002688.PE178

CP002688.PE178       Location/Qualifiers
FT   CDS             join(359154..359714,359784..359957,360042..360446,
FT                   360520..360867)
FT                   /codon_start=1
FT                   /gene="STN8"
FT                   /gene_synonym="STATE TRANSITION 8"
FT                   /gene_synonym="T20L15.190"
FT                   /gene_synonym="T20L15_190"
FT                   /gene_synonym="State transition 8"
FT                   /locus_tag="AT5G01920"
FT                   /product="Protein kinase superfamily protein"
FT                   /note="STN8; FUNCTIONS IN: protein kinase activity, kinase
FT                   activity; INVOLVED IN: photosystem II stabilization;
FT                   LOCATED IN: thylakoid, chloroplast; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein kinase, core
FT                   (InterPro:IPR000719), Serine/threonine protein
FT                   kinase-related (InterPro:IPR017442), Protein kinase-like
FT                   (InterPro:IPR011009), Serine/threonine protein kinase,
FT                   active site (InterPro:IPR008271); BEST Arabidopsis thaliana
FT                   protein match is: STN7 (Stt7 homolog STN7); kinase/ protein
FT                   kinase (TAIR:AT1G68830.1); Has 33057 Blast hits to 33030
FT                   proteins in 1682 species: Archae - 26; Bacteria - 4053;
FT                   Metazoa - 14243; Fungi - 4538; Plants - 3212; Viruses - 96;
FT                   Other Eukaryotes - 6889 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZV4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH876384.1,INSD:EH950729.1,INSD:AV439725.1,
FT                   INSD:EH938339.1,INSD:EL302052.1,INSD:EL977838.1,
FT                   INSD:EH839753.1,INSD:EL116967.1,INSD:EL180379.1,
FT                   INSD:T45796.1,INSD:ES141832.1,INSD:BP639025.1,
FT                   INSD:EL310215.1,INSD:EH872822.1,INSD:EH946965.1,
FT                   INSD:EL166710.1,INSD:ES192978.1,INSD:EL036614.1,
FT                   INSD:EL070085.1,INSD:EL325644.1,INSD:EH859208.1,
FT                   INSD:EL002181.1,INSD:EL018655.1,INSD:EL042271.1,
FT                   INSD:AV528501.1,INSD:EL315440.1,INSD:AU036595.1,
FT                   INSD:EL154510.1,INSD:EH886935.1,INSD:EL063804.1,
FT                   INSD:AV522946.1,INSD:N37171.1,INSD:EL312318.1,
FT                   INSD:AU229659.1,INSD:AU237907.2,INSD:EL268923.1,
FT                   INSD:N65375.1,INSD:T45057.1,INSD:ES140505.1,
FT                   INSD:EG522395.1,INSD:AU238469.1,INSD:EL282868.1,
FT                   INSD:EL176046.1,INSD:BP812686.1,INSD:EG522394.1,
FT                   INSD:EL150970.1,INSD:AV561129.1,INSD:DR360743.1,
FT                   INSD:AI994858.1,INSD:EL024500.1,INSD:DR260570.1,
FT                   INSD:BP796665.1,INSD:BP609170.1,INSD:EH818179.1,
FT                   INSD:EL033062.1,INSD:EH938199.1,INSD:AU229015.1,
FT                   INSD:EH934159.1,INSD:AU036582.1,INSD:EL068336.1,
FT                   INSD:AI994926.1,INSD:ES005506.1,INSD:DR382295.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK117124.1,INSD:BT006132.1,INSD:AK117628.1"
FT                   /protein_id="AED90410.1"
FT                   /translation="MASLLSPATPTATSAAFHSCSTAGFSTPTHISSQNSSLSLLSRRG
FT                   CMMRCSFSPQDIPVDSLSHLPPFLDFQNSLATFSDTQKWGFFVSAGIVWFYLTARPGVL
FT                   IGAIDAYLLAPLQLGLDTLIGRRLKRSDFLVTEKLGEGSFGVVYAGVLLPKNSTLVDDV
FT                   RVSKARAKAMDFTGEFKQRVILKKVKVGVRGAEEFGEYEEWFNYRLSRAAPDTCAEFLG
FT                   SFVADKTNTMFTKGGKWLVWRFEGDRDLADYMKDRSFPSNLESIMFGRVLQGVESVKRR
FT                   ALIIKQIMRQIITSLRKIHGTGIVHRDVKPANLVVTKKGQIKLIDFGAAADLRIGKNYI
FT                   PERTLLDPDYCPPELYVLPEETPSPPPEPIAALLSPILWQLNSPDLFDMYSAGIVLLQM
FT                   AVPTLRSTAGLKNFNLEIKSVEYDLNRWRERTRTRPDLSILDLDSGRGWDLVTKLISER
FT                   GSLRRGRLSAAAALRHPYFLLGGDQAAAVLSKLSFSK"
     MASLLSPATP TATSAAFHSC STAGFSTPTH ISSQNSSLSL LSRRGCMMRC SFSPQDIPVD        60
     SLSHLPPFLD FQNSLATFSD TQKWGFFVSA GIVWFYLTAR PGVLIGAIDA YLLAPLQLGL       120
     DTLIGRRLKR SDFLVTEKLG EGSFGVVYAG VLLPKNSTLV DDVRVSKARA KAMDFTGEFK       180
     QRVILKKVKV GVRGAEEFGE YEEWFNYRLS RAAPDTCAEF LGSFVADKTN TMFTKGGKWL       240
     VWRFEGDRDL ADYMKDRSFP SNLESIMFGR VLQGVESVKR RALIIKQIMR QIITSLRKIH       300
     GTGIVHRDVK PANLVVTKKG QIKLIDFGAA ADLRIGKNYI PERTLLDPDY CPPELYVLPE       360
     ETPSPPPEPI AALLSPILWQ LNSPDLFDMY SAGIVLLQMA VPTLRSTAGL KNFNLEIKSV       420
     EYDLNRWRER TRTRPDLSIL DLDSGRGWDL VTKLISERGS LRRGRLSAAA ALRHPYFLLG       480
     GDQAAAVLSK LSFSK                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page