(data stored in ACNUC13479 zone)

EMBL: CP002688.PE18

CP002688.PE18        Location/Qualifiers
FT   CDS             complement(join(25094..25343,25429..25799))
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.50"
FT                   /gene_synonym="F7J8_50"
FT                   /locus_tag="AT5G01070"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /note="RING/FYVE/PHD zinc finger superfamily protein;
FT                   FUNCTIONS IN: zinc ion binding; CONTAINS InterPro DOMAIN/s:
FT                   Zinc finger, C3HC4 RING-type (InterPro:IPR018957), Zinc
FT                   finger, RING-CH-type (InterPro:IPR011016); BEST Arabidopsis
FT                   thaliana protein match is: RING/FYVE/PHD zinc finger
FT                   superfamily protein (TAIR:AT2G37950.1); Has 1807 Blast hits
FT                   to 1807 proteins in 277 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:F4K7X7"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7X7"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024791.1,INSD:DQ059128.1"
FT                   /protein_id="AED90294.2"
FT                   /translation="MSSYEISHIDLENGSGERQYRPSDVSGEDSSSCDYDYDFHSAVRS
FT                   FCGEFEIADDLDDETDTESVASGSIRGSPEKDCRICHLGLESSRHECGDPMVLGCSCKD
FT                   DLGYVHKQCADTWFKIKGNKTCEICRSIAQNFFKVDNEIGQTTVETNVDDVEAGNTPTM
FT                   VATSDSDDRRLCRGNRFLNFLLTCMVCAFVISWFFHFNLPSHK"
     MSSYEISHID LENGSGERQY RPSDVSGEDS SSCDYDYDFH SAVRSFCGEF EIADDLDDET        60
     DTESVASGSI RGSPEKDCRI CHLGLESSRH ECGDPMVLGC SCKDDLGYVH KQCADTWFKI       120
     KGNKTCEICR SIAQNFFKVD NEIGQTTVET NVDDVEAGNT PTMVATSDSD DRRLCRGNRF       180
     LNFLLTCMVC AFVISWFFHF NLPSHK                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page