(data stored in ACNUC13479 zone)

EMBL: CP002688.PE180

CP002688.PE180       Location/Qualifiers
FT   CDS             complement(join(363594..363635,363732..363820,
FT                   363913..364055,364135..364277,364357..364418,
FT                   364526..364625,364701..364865))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.210"
FT                   /gene_synonym="T20L15_210"
FT                   /locus_tag="AT5G01940"
FT                   /product="eukaryotic translation initiation factor 2B
FT                   family protein / eIF-2B family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01940"
FT                   /db_xref="GOA:A0A1P8BFD8"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BFD8"
FT                   /protein_id="ANM70277.1"
FT                   /translation="MSEGPIQAQSQSLVSFLIFLRSTLKLVDPPATMDLQQKQACWKLE
FT                   LEVIDNDSSWVSKFDPSKKKKKKKQKPLIREDDIFFQNGGHFTEDNLPDCQSSRKFEPD
FT                   YGYKELLSMVFDRLREEDVEVSTERPRTVMMPPQLLAEGTITVCLNFADLCRTMHRKPD
FT                   HVMKFLLAQMETKVSLNKQQRLEIKGLVSSKDFQAVFRKYIDAFVICVCCKSPDTALAE
FT                   EGNGLFNLRCETCGLVAPVDIPNLL"
     MSEGPIQAQS QSLVSFLIFL RSTLKLVDPP ATMDLQQKQA CWKLELEVID NDSSWVSKFD        60
     PSKKKKKKKQ KPLIREDDIF FQNGGHFTED NLPDCQSSRK FEPDYGYKEL LSMVFDRLRE       120
     EDVEVSTERP RTVMMPPQLL AEGTITVCLN FADLCRTMHR KPDHVMKFLL AQMETKVSLN       180
     KQQRLEIKGL VSSKDFQAVF RKYIDAFVIC VCCKSPDTAL AEEGNGLFNL RCETCGLVAP       240
     VDIPNLL                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page