(data stored in ACNUC13479 zone)

EMBL: CP002688.PE181

CP002688.PE181       Location/Qualifiers
FT   CDS             complement(join(363594..363635,363732..363820,
FT                   363913..364055,364135..364277,364357..364418,
FT                   364526..364625,364701..364769))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.210"
FT                   /gene_synonym="T20L15_210"
FT                   /locus_tag="AT5G01940"
FT                   /product="eukaryotic translation initiation factor 2B
FT                   family protein / eIF-2B family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01940"
FT                   /db_xref="GOA:A0A178UNV7"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178UNV7"
FT                   /protein_id="ANM70276.1"
FT                   /translation="MDLQQKQACWKLELEVIDNDSSWVSKFDPSKKKKKKKQKPLIRED
FT                   DIFFQNGGHFTEDNLPDCQSSRKFEPDYGYKELLSMVFDRLREEDVEVSTERPRTVMMP
FT                   PQLLAEGTITVCLNFADLCRTMHRKPDHVMKFLLAQMETKVSLNKQQRLEIKGLVSSKD
FT                   FQAVFRKYIDAFVICVCCKSPDTALAEEGNGLFNLRCETCGLVAPVDIPNLL"
     MDLQQKQACW KLELEVIDND SSWVSKFDPS KKKKKKKQKP LIREDDIFFQ NGGHFTEDNL        60
     PDCQSSRKFE PDYGYKELLS MVFDRLREED VEVSTERPRT VMMPPQLLAE GTITVCLNFA       120
     DLCRTMHRKP DHVMKFLLAQ METKVSLNKQ QRLEIKGLVS SKDFQAVFRK YIDAFVICVC       180
     CKSPDTALAE EGNGLFNLRC ETCGLVAPVD IPNLL                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page