(data stored in ACNUC13479 zone)

EMBL: CP002688.PE182

CP002688.PE182       Location/Qualifiers
FT   CDS             complement(join(363594..363683,363732..363820,
FT                   363913..364055,364135..364277,364357..364418,
FT                   364526..364625,364701..364769))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.210"
FT                   /gene_synonym="T20L15_210"
FT                   /locus_tag="AT5G01940"
FT                   /product="eukaryotic translation initiation factor 2B
FT                   family protein / eIF-2B family protein"
FT                   /note="eukaryotic translation initiation factor 2B family
FT                   protein / eIF-2B family protein; FUNCTIONS IN: translation
FT                   initiation factor activity; INVOLVED IN: translational
FT                   initiation; LOCATED IN: cellular_component unknown;
FT                   EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 12
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Translation
FT                   initiation factor IF2/IF5, N-terminal (InterPro:IPR016189),
FT                   Translation initiation factor IF2/IF5 (InterPro:IPR002735);
FT                   BEST Arabidopsis thaliana protein match is: eukaryotic
FT                   translation initiation factor 2 beta subunit
FT                   (TAIR:AT5G20920.2); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01940"
FT                   /db_xref="GOA:Q9LZV2"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZV2"
FT                   /inference="similar to RNA sequence, EST:INSD:EL192540.1"
FT                   /protein_id="AED90412.1"
FT                   /translation="MDLQQKQACWKLELEVIDNDSSWVSKFDPSKKKKKKKQKPLIRED
FT                   DIFFQNGGHFTEDNLPDCQSSRKFEPDYGYKELLSMVFDRLREEDVEVSTERPRTVMMP
FT                   PQLLAEGTITVCLNFADLCRTMHRKPDHVMKFLLAQMETKVSLNKQQRLEIKGLVSSKD
FT                   FQAVFRKYIDAFVICVCCKSPDTALAEEGNGLFNLRCETGKDEDKLVSFESVLVQCGLV
FT                   APVDIPNLL"
     MDLQQKQACW KLELEVIDND SSWVSKFDPS KKKKKKKQKP LIREDDIFFQ NGGHFTEDNL        60
     PDCQSSRKFE PDYGYKELLS MVFDRLREED VEVSTERPRT VMMPPQLLAE GTITVCLNFA       120
     DLCRTMHRKP DHVMKFLLAQ METKVSLNKQ QRLEIKGLVS SKDFQAVFRK YIDAFVICVC       180
     CKSPDTALAE EGNGLFNLRC ETGKDEDKLV SFESVLVQCG LVAPVDIPNL L                231
//

If you have problems or comments...

PBIL Back to PBIL home page