(data stored in ACNUC13479 zone)

EMBL: CP002688.PE185

CP002688.PE185       Location/Qualifiers
FT   CDS             complement(join(365040..365507,365585..365835,
FT                   365919..365970,366062..366345,366430..366588,
FT                   366682..367202,367278..367346,367434..367520,
FT                   367615..367686,367795..367863,367941..368009,
FT                   368114..368188,368266..368337,368419..368490,
FT                   368583..368726,368833..368904,369011..369082,
FT                   369285..369532))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.220"
FT                   /gene_synonym="T20L15_220"
FT                   /locus_tag="AT5G01950"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01950"
FT                   /db_xref="GOA:F4KAX4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F4KAX4"
FT                   /protein_id="ANM68705.1"
FT                   /translation="MVFPQRLYLHALLVACCCVLLLADAQRTHPSEVTALRSVKRSLLD
FT                   PKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHL
FT                   EILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNIT
FT                   GPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALP
FT                   NLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNE
FT                   LTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKN
FT                   ISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGSISNANLFCESKGKE
FT                   WISLPNNSTNSALDCPPLACPTPDFYEYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPY
FT                   IDQFGEYVTDFLQMEPYQLWIDSYQWEKGPRLRMYLKLFPKVNETYTRTFNESEVLRIR
FT                   GIFASWRFPGSDLFGPYELLNFTLQGPYSYVNFNSERKGVSWRRLAAITAGAVVTAVAI
FT                   SAVVAALLLRRYSKHEREISRRRSSSKASLLNSGIRGFSFKELAEATDDFSSSTLVGRG
FT                   GYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESE
FT                   QMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKA
FT                   SNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDK
FT                   SDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFA
FT                   ALALRCSHDSPEMRPGMAEVVKELESLLQASPDRETRVELASSSSVLSTSSSNVTRDLY
FT                   ESSSLLGSDLSSGFVPSIAPR"
     MVFPQRLYLH ALLVACCCVL LLADAQRTHP SEVTALRSVK RSLLDPKDYL RNWNRGDPCR        60
     SNWTGVICFN EIGTDDYLHV RELLLMNMNL SGTLSPELQK LAHLEILDFM WNNISGSIPN       120
     EIGQISSLVL LLLNGNKLSG TLPSELGYLS NLNRFQIDEN NITGPIPKSF SNLKKVKHLH       180
     FNNNSLTGQI PVELSNLTNI FHVLLDNNKL SGNLPPQLSA LPNLQILQLD NNNFSGSDIP       240
     ASYGNFSNIL KLSLRNCSLK GALPDFSKIR HLKYLDLSWN ELTGPIPSSN FSKDVTTINL       300
     SNNILNGSIP QSFSDLPLLQ MLLLKNNMLS GSVPDSLWKN ISFPKKARLL LDLRNNSLSR       360
     VQGDLTPPQN VTLRLDGNLI CTNGSISNAN LFCESKGKEW ISLPNNSTNS ALDCPPLACP       420
     TPDFYEYSPA SPLRCFCAAP LRIGYRLKSP SFSYFPPYID QFGEYVTDFL QMEPYQLWID       480
     SYQWEKGPRL RMYLKLFPKV NETYTRTFNE SEVLRIRGIF ASWRFPGSDL FGPYELLNFT       540
     LQGPYSYVNF NSERKGVSWR RLAAITAGAV VTAVAISAVV AALLLRRYSK HEREISRRRS       600
     SSKASLLNSG IRGFSFKELA EATDDFSSST LVGRGGYGKV YRGVLSDNTV AAIKRADEGS       660
     LQGEKEFLNE IELLSRLHHR NLVSLIGYCD EESEQMLVYE FMSNGTLRDW LSAKGKESLS       720
     FGMRIRVALG AAKGILYLHT EANPPVFHRD IKASNILLDP NFNAKVADFG LSRLAPVLED       780
     EEDVPKHVST VVRGTPGYLD PEYFLTHKLT DKSDVYSIGV VFLELLTGMH AISHGKNIVR       840
     EVKTAEQRDM MVSLIDKRME PWSMESVEKF AALALRCSHD SPEMRPGMAE VVKELESLLQ       900
     ASPDRETRVE LASSSSVLST SSSNVTRDLY ESSSLLGSDL SSGFVPSIAP R                951
//

If you have problems or comments...

PBIL Back to PBIL home page