(data stored in ACNUC13479 zone)

EMBL: CP002688.PE186

CP002688.PE186       Location/Qualifiers
FT   CDS             complement(join(365040..365507,365585..365835,
FT                   365919..365970,366062..366345,366430..366588,
FT                   366682..367202,367278..367346,367434..367520,
FT                   367615..367686,367795..367863,367941..368009,
FT                   368114..368188,368266..368337,368419..368490,
FT                   368583..368726,368833..368904,369011..369082,
FT                   369285..369532))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.220"
FT                   /gene_synonym="T20L15_220"
FT                   /locus_tag="AT5G01950"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /note="Leucine-rich repeat protein kinase family protein;
FT                   FUNCTIONS IN: protein serine/threonine kinase activity,
FT                   kinase activity, ATP binding; INVOLVED IN: transmembrane
FT                   receptor protein tyrosine kinase signaling pathway, protein
FT                   amino acid phosphorylation; LOCATED IN: chloroplast, plasma
FT                   membrane; EXPRESSED IN: 19 plant structures; EXPRESSED
FT                   DURING: 10 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Protein kinase, ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Leucine-rich repeat-containing
FT                   N-terminal domain, type 2 (InterPro:IPR013210),
FT                   Leucine-rich repeat (InterPro:IPR001611),
FT                   Serine/threonine-protein kinase-like domain
FT                   (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), Protein kinase, catalytic
FT                   domain (InterPro:IPR000719), Tyrosine-protein kinase,
FT                   catalytic domain (InterPro:IPR020635); BEST Arabidopsis
FT                   thaliana protein match is: Leucine-rich repeat protein
FT                   kinase family protein (TAIR:AT1G06840.1); Has 195622 Blast
FT                   hits to 137374 proteins in 5075 species: Archae - 144;
FT                   Bacteria - 18537; Metazoa - 60927; Fungi - 10261; Plants -
FT                   82888; Viruses - 345; Other Eukaryotes - 22520 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:F4KAX4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F4KAX4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA712879.1,INSD:AV523401.1,INSD:BP839115.1,
FT                   INSD:CA782044.1,INSD:EL163808.1,INSD:DR368835.1,
FT                   INSD:AV529062.1,INSD:AI993749.1,INSD:ES037161.1,
FT                   INSD:AV526845.1,INSD:ES143186.1,INSD:DR383549.1,
FT                   INSD:AV547400.1,INSD:AV522986.1,INSD:EL983739.1,
FT                   INSD:AV523939.1,INSD:AU036572.1"
FT                   /protein_id="AED90413.1"
FT                   /translation="MVFPQRLYLHALLVACCCVLLLADAQRTHPSEVTALRSVKRSLLD
FT                   PKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHL
FT                   EILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNIT
FT                   GPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALP
FT                   NLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNE
FT                   LTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKN
FT                   ISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGSISNANLFCESKGKE
FT                   WISLPNNSTNSALDCPPLACPTPDFYEYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPY
FT                   IDQFGEYVTDFLQMEPYQLWIDSYQWEKGPRLRMYLKLFPKVNETYTRTFNESEVLRIR
FT                   GIFASWRFPGSDLFGPYELLNFTLQGPYSYVNFNSERKGVSWRRLAAITAGAVVTAVAI
FT                   SAVVAALLLRRYSKHEREISRRRSSSKASLLNSGIRGFSFKELAEATDDFSSSTLVGRG
FT                   GYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESE
FT                   QMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKA
FT                   SNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDK
FT                   SDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFA
FT                   ALALRCSHDSPEMRPGMAEVVKELESLLQASPDRETRVELASSSSVLSTSSSNVTRDLY
FT                   ESSSLLGSDLSSGFVPSIAPR"
     MVFPQRLYLH ALLVACCCVL LLADAQRTHP SEVTALRSVK RSLLDPKDYL RNWNRGDPCR        60
     SNWTGVICFN EIGTDDYLHV RELLLMNMNL SGTLSPELQK LAHLEILDFM WNNISGSIPN       120
     EIGQISSLVL LLLNGNKLSG TLPSELGYLS NLNRFQIDEN NITGPIPKSF SNLKKVKHLH       180
     FNNNSLTGQI PVELSNLTNI FHVLLDNNKL SGNLPPQLSA LPNLQILQLD NNNFSGSDIP       240
     ASYGNFSNIL KLSLRNCSLK GALPDFSKIR HLKYLDLSWN ELTGPIPSSN FSKDVTTINL       300
     SNNILNGSIP QSFSDLPLLQ MLLLKNNMLS GSVPDSLWKN ISFPKKARLL LDLRNNSLSR       360
     VQGDLTPPQN VTLRLDGNLI CTNGSISNAN LFCESKGKEW ISLPNNSTNS ALDCPPLACP       420
     TPDFYEYSPA SPLRCFCAAP LRIGYRLKSP SFSYFPPYID QFGEYVTDFL QMEPYQLWID       480
     SYQWEKGPRL RMYLKLFPKV NETYTRTFNE SEVLRIRGIF ASWRFPGSDL FGPYELLNFT       540
     LQGPYSYVNF NSERKGVSWR RLAAITAGAV VTAVAISAVV AALLLRRYSK HEREISRRRS       600
     SSKASLLNSG IRGFSFKELA EATDDFSSST LVGRGGYGKV YRGVLSDNTV AAIKRADEGS       660
     LQGEKEFLNE IELLSRLHHR NLVSLIGYCD EESEQMLVYE FMSNGTLRDW LSAKGKESLS       720
     FGMRIRVALG AAKGILYLHT EANPPVFHRD IKASNILLDP NFNAKVADFG LSRLAPVLED       780
     EEDVPKHVST VVRGTPGYLD PEYFLTHKLT DKSDVYSIGV VFLELLTGMH AISHGKNIVR       840
     EVKTAEQRDM MVSLIDKRME PWSMESVEKF AALALRCSHD SPEMRPGMAE VVKELESLLQ       900
     ASPDRETRVE LASSSSVLST SSSNVTRDLY ESSSLLGSDL SSGFVPSIAP R                951
//

If you have problems or comments...

PBIL Back to PBIL home page