(data stored in ACNUC13479 zone)

EMBL: CP002688.PE187

CP002688.PE187       Location/Qualifiers
FT   CDS             complement(join(365040..365507,365585..365835,
FT                   365919..365985,366062..366345,366430..366588,
FT                   366682..367202,367278..367346,367434..367520,
FT                   367615..367686,367795..367863,367941..368009,
FT                   368114..368188,368266..368337,368419..368490,
FT                   368583..368726,368833..368904,369011..369082,
FT                   369285..369532))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.220"
FT                   /gene_synonym="T20L15_220"
FT                   /locus_tag="AT5G01950"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01950"
FT                   /db_xref="GOA:A0A1P8BAT4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAT4"
FT                   /protein_id="ANM68703.1"
FT                   /translation="MVFPQRLYLHALLVACCCVLLLADAQRTHPSEVTALRSVKRSLLD
FT                   PKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHL
FT                   EILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNIT
FT                   GPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALP
FT                   NLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNE
FT                   LTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKN
FT                   ISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGSISNANLFCESKGKE
FT                   WISLPNNSTNSALDCPPLACPTPDFYEYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPY
FT                   IDQFGEYVTDFLQMEPYQLWIDSYQWEKGPRLRMYLKLFPKVNETYTRTFNESEVLRIR
FT                   GIFASWRFPGSDLFGPYELLNFTLQGPYSYVNFNSERKGVSWRRLAAITAGAVVTAVAI
FT                   SAVVAALLLRRYSKHEREISRRRSSSKASLLNSGIRGFSFKELAEATDDFSSSTLVGRG
FT                   GYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESE
FT                   QLLNLQMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFH
FT                   RDIKASNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTH
FT                   KLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMES
FT                   VEKFAALALRCSHDSPEMRPGMAEVVKELESLLQASPDRETRVELASSSSVLSTSSSNV
FT                   TRDLYESSSLLGSDLSSGFVPSIAPR"
     MVFPQRLYLH ALLVACCCVL LLADAQRTHP SEVTALRSVK RSLLDPKDYL RNWNRGDPCR        60
     SNWTGVICFN EIGTDDYLHV RELLLMNMNL SGTLSPELQK LAHLEILDFM WNNISGSIPN       120
     EIGQISSLVL LLLNGNKLSG TLPSELGYLS NLNRFQIDEN NITGPIPKSF SNLKKVKHLH       180
     FNNNSLTGQI PVELSNLTNI FHVLLDNNKL SGNLPPQLSA LPNLQILQLD NNNFSGSDIP       240
     ASYGNFSNIL KLSLRNCSLK GALPDFSKIR HLKYLDLSWN ELTGPIPSSN FSKDVTTINL       300
     SNNILNGSIP QSFSDLPLLQ MLLLKNNMLS GSVPDSLWKN ISFPKKARLL LDLRNNSLSR       360
     VQGDLTPPQN VTLRLDGNLI CTNGSISNAN LFCESKGKEW ISLPNNSTNS ALDCPPLACP       420
     TPDFYEYSPA SPLRCFCAAP LRIGYRLKSP SFSYFPPYID QFGEYVTDFL QMEPYQLWID       480
     SYQWEKGPRL RMYLKLFPKV NETYTRTFNE SEVLRIRGIF ASWRFPGSDL FGPYELLNFT       540
     LQGPYSYVNF NSERKGVSWR RLAAITAGAV VTAVAISAVV AALLLRRYSK HEREISRRRS       600
     SSKASLLNSG IRGFSFKELA EATDDFSSST LVGRGGYGKV YRGVLSDNTV AAIKRADEGS       660
     LQGEKEFLNE IELLSRLHHR NLVSLIGYCD EESEQLLNLQ MLVYEFMSNG TLRDWLSAKG       720
     KESLSFGMRI RVALGAAKGI LYLHTEANPP VFHRDIKASN ILLDPNFNAK VADFGLSRLA       780
     PVLEDEEDVP KHVSTVVRGT PGYLDPEYFL THKLTDKSDV YSIGVVFLEL LTGMHAISHG       840
     KNIVREVKTA EQRDMMVSLI DKRMEPWSME SVEKFAALAL RCSHDSPEMR PGMAEVVKEL       900
     ESLLQASPDR ETRVELASSS SVLSTSSSNV TRDLYESSSL LGSDLSSGFV PSIAPR           956
//

If you have problems or comments...

PBIL Back to PBIL home page