(data stored in ACNUC13479 zone)

EMBL: CP002688.PE188

CP002688.PE188       Location/Qualifiers
FT   CDS             complement(join(365040..365507,365585..365835,
FT                   365919..365970,366062..366345,366430..366588,
FT                   366682..367202,367278..367346,367434..367520,
FT                   367615..367686,367795..367863,367941..368009,
FT                   368114..368188,368266..368337,368419..368490,
FT                   368583..368726,368833..368904,369011..369075))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.220"
FT                   /gene_synonym="T20L15_220"
FT                   /locus_tag="AT5G01950"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01950"
FT                   /db_xref="GOA:A0A1P8BAU6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAU6"
FT                   /protein_id="ANM68706.1"
FT                   /translation="MNMNLSGTLSPELQKLAHLEILDFMWNNISGSIPNEIGQISSLVL
FT                   LLLNGNKLSGTLPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKHLHFNNNSLTGQ
FT                   IPVELSNLTNIFHVLLDNNKLSGNLPPQLSALPNLQILQLDNNNFSGSDIPASYGNFSN
FT                   ILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSKDVTTINLSNNILNG
FT                   SIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKNISFPKKARLLLDLRNNSLSRVQGDLT
FT                   PPQNVTLRLDGNLICTNGSISNANLFCESKGKEWISLPNNSTNSALDCPPLACPTPDFY
FT                   EYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPYIDQFGEYVTDFLQMEPYQLWIDSYQW
FT                   EKGPRLRMYLKLFPKVNETYTRTFNESEVLRIRGIFASWRFPGSDLFGPYELLNFTLQG
FT                   PYSYVNFNSERKGVSWRRLAAITAGAVVTAVAISAVVAALLLRRYSKHEREISRRRSSS
FT                   KASLLNSGIRGFSFKELAEATDDFSSSTLVGRGGYGKVYRGVLSDNTVAAIKRADEGSL
FT                   QGEKEFLNEIELLSRLHHRNLVSLIGYCDEESEQMLVYEFMSNGTLRDWLSAKGKESLS
FT                   FGMRIRVALGAAKGILYLHTEANPPVFHRDIKASNILLDPNFNAKVADFGLSRLAPVLE
FT                   DEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNI
FT                   VREVKTAEQRDMMVSLIDKRMEPWSMESVEKFAALALRCSHDSPEMRPGMAEVVKELES
FT                   LLQASPDRETRVELASSSSVLSTSSSNVTRDLYESSSLLGSDLSSGFVPSIAPR"
     MNMNLSGTLS PELQKLAHLE ILDFMWNNIS GSIPNEIGQI SSLVLLLLNG NKLSGTLPSE        60
     LGYLSNLNRF QIDENNITGP IPKSFSNLKK VKHLHFNNNS LTGQIPVELS NLTNIFHVLL       120
     DNNKLSGNLP PQLSALPNLQ ILQLDNNNFS GSDIPASYGN FSNILKLSLR NCSLKGALPD       180
     FSKIRHLKYL DLSWNELTGP IPSSNFSKDV TTINLSNNIL NGSIPQSFSD LPLLQMLLLK       240
     NNMLSGSVPD SLWKNISFPK KARLLLDLRN NSLSRVQGDL TPPQNVTLRL DGNLICTNGS       300
     ISNANLFCES KGKEWISLPN NSTNSALDCP PLACPTPDFY EYSPASPLRC FCAAPLRIGY       360
     RLKSPSFSYF PPYIDQFGEY VTDFLQMEPY QLWIDSYQWE KGPRLRMYLK LFPKVNETYT       420
     RTFNESEVLR IRGIFASWRF PGSDLFGPYE LLNFTLQGPY SYVNFNSERK GVSWRRLAAI       480
     TAGAVVTAVA ISAVVAALLL RRYSKHEREI SRRRSSSKAS LLNSGIRGFS FKELAEATDD       540
     FSSSTLVGRG GYGKVYRGVL SDNTVAAIKR ADEGSLQGEK EFLNEIELLS RLHHRNLVSL       600
     IGYCDEESEQ MLVYEFMSNG TLRDWLSAKG KESLSFGMRI RVALGAAKGI LYLHTEANPP       660
     VFHRDIKASN ILLDPNFNAK VADFGLSRLA PVLEDEEDVP KHVSTVVRGT PGYLDPEYFL       720
     THKLTDKSDV YSIGVVFLEL LTGMHAISHG KNIVREVKTA EQRDMMVSLI DKRMEPWSME       780
     SVEKFAALAL RCSHDSPEMR PGMAEVVKEL ESLLQASPDR ETRVELASSS SVLSTSSSNV       840
     TRDLYESSSL LGSDLSSGFV PSIAPR                                            866
//

If you have problems or comments...

PBIL Back to PBIL home page