(data stored in ACNUC13479 zone)

EMBL: CP002688.PE191

CP002688.PE191       Location/Qualifiers
FT   CDS             join(370811..371303,371390..371466,371547..371715,
FT                   371872..371960,372074..372238,372316..372393,
FT                   372487..372590,372670..372775)
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.10"
FT                   /gene_synonym="T7H20_10"
FT                   /locus_tag="AT5G01960"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; LOCATED IN: chloroplast; EXPRESSED IN: 23
FT                   plant structures; EXPRESSED DURING: 14 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type,
FT                   conserved site (InterPro:IPR017907), Zinc finger, RING-type
FT                   (InterPro:IPR001841), Zinc finger, C3HC4 RING-type
FT                   (InterPro:IPR018957); BEST Arabidopsis thaliana protein
FT                   match is: RING/U-box superfamily protein
FT                   (TAIR:AT1G65040.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01960"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01960.1"
FT                   /db_xref="GOA:Q8L610"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L610"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL258898.1,INSD:DR265258.1,INSD:DR265259.1,
FT                   INSD:ES132740.1,INSD:BP602982.1,INSD:EL015073.1,
FT                   INSD:DR376177.1,INSD:EH885634.1,INSD:BP617848.1,
FT                   INSD:EL276317.1,INSD:BP798101.1,INSD:ES140842.1,
FT                   INSD:ES054192.1,INSD:BP811157.1,INSD:EH806755.1,
FT                   INSD:BP633168.1,INSD:EH891928.1,INSD:ES181425.1,
FT                   INSD:AA651156.1,INSD:BP778029.1,INSD:EL973782.1,
FT                   INSD:EL991767.1,INSD:BP671641.1,INSD:EL266887.1,
FT                   INSD:DR265260.1,INSD:ES088035.1,INSD:EL260254.1,
FT                   INSD:BP619694.1,INSD:ES022858.1,INSD:EG463064.1,
FT                   INSD:AV562969.1,INSD:DR265264.1,INSD:BP827788.1,
FT                   INSD:DR265261.1,INSD:BP610341.1,INSD:AV440114.1,
FT                   INSD:AV830898.1,INSD:ES012017.1,INSD:EH828778.1,
FT                   INSD:CD530902.1,INSD:DR265262.1,INSD:BP866120.2,
FT                   INSD:EH862623.1,INSD:BP623208.1,INSD:AV809752.1,
FT                   INSD:EL971150.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY087766.1,INSD:BX832142.1,INSD:AY099711.1,
FT                   INSD:BX831206.1,INSD:BX832766.1,INSD:BT000282.1"
FT                   /protein_id="AED90414.1"
FT                   /translation="METPGASHDSFRGSPRRNSILSASNIIQAPISTLLEYSGLFRARP
FT                   SPSHEAETLVSDDSSGLSNGEVAIRIIGNTEQDAETDTNALREPGHSELLGSSATQVDP
FT                   MGGASEGASQAAPGDPAAGDAASRDSPYQRYDIQQAARWIEQILPFSLLLLVVFIRQHL
FT                   QGFFVAIWIAAVMFKSNDILKKQTALKGERHISALIGISVAFTAHVVGVYWWFRKDDLL
FT                   YPLIMLPPKSIPPFWHAIFIIVVNDTLVRQASMIFKCFLLMYYKNSRGRNYRKQGQLLT
FT                   LVEYFMLLYRSLLPTPVWYRFFLNKDYGSLFSSLMTGLYLTFKLTSVVEKVQSFFTALK
FT                   ALSRKEVHYGSYATTEQVNAAGDLCAICQEKMHTPILLRCKHMFCEDCVSEWFERERTC
FT                   PLCRALVKPADLKSFGDGSTSLFFQIF"
     METPGASHDS FRGSPRRNSI LSASNIIQAP ISTLLEYSGL FRARPSPSHE AETLVSDDSS        60
     GLSNGEVAIR IIGNTEQDAE TDTNALREPG HSELLGSSAT QVDPMGGASE GASQAAPGDP       120
     AAGDAASRDS PYQRYDIQQA ARWIEQILPF SLLLLVVFIR QHLQGFFVAI WIAAVMFKSN       180
     DILKKQTALK GERHISALIG ISVAFTAHVV GVYWWFRKDD LLYPLIMLPP KSIPPFWHAI       240
     FIIVVNDTLV RQASMIFKCF LLMYYKNSRG RNYRKQGQLL TLVEYFMLLY RSLLPTPVWY       300
     RFFLNKDYGS LFSSLMTGLY LTFKLTSVVE KVQSFFTALK ALSRKEVHYG SYATTEQVNA       360
     AGDLCAICQE KMHTPILLRC KHMFCEDCVS EWFERERTCP LCRALVKPAD LKSFGDGSTS       420
     LFFQIF                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page