(data stored in ACNUC13479 zone)

EMBL: CP002688.PE192

CP002688.PE192       Location/Qualifiers
FT   CDS             complement(join(373014..373319,373401..373568,
FT                   373660..373863,373942..374067,374166..374270,
FT                   374505..374651))
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.20"
FT                   /gene_synonym="T7H20_20"
FT                   /locus_tag="AT5G01970"
FT                   /product="heat-inducible transcription repressor"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT1G30050.1); Has 240 Blast
FT                   hits to 236 proteins in 72 species: Archae - 0; Bacteria -
FT                   15; Metazoa - 51; Fungi - 19; Plants - 119; Viruses - 0;
FT                   Other Eukaryotes - 36 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01970"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZN4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES148234.1,INSD:ES088521.1,INSD:DR364977.1,
FT                   INSD:BP602982.1,INSD:AV813758.1,INSD:BP852438.1,
FT                   INSD:DR376177.1,INSD:EL993490.1,INSD:EH885634.1,
FT                   INSD:BP617848.1,INSD:EL261050.1,INSD:BP610341.1,
FT                   INSD:BP854911.1,INSD:BP633168.1,INSD:AV440114.1,
FT                   INSD:ES216087.1,INSD:ES060403.1,INSD:ES199462.1,
FT                   INSD:AA651156.1,INSD:BP671641.1,INSD:EH862623.1,
FT                   INSD:AV830045.1,INSD:BP854344.1,INSD:AV809752.1,
FT                   INSD:AV535704.1,INSD:BP619694.1,INSD:BP808597.1,
FT                   INSD:EL052097.1,INSD:ES048200.1,INSD:DR384098.1,
FT                   INSD:EG463064.1,INSD:EL031229.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832073.1,INSD:AY072408.1,INSD:BT000237.1"
FT                   /protein_id="AED90415.1"
FT                   /translation="MAYRRRQGIGKFATFKEEVDRLPPESITAVKDRSPPARSSPAFDQ
FT                   PRSKNFTTEPKGLWGVIAQKAKSVIEDDKSSDRSTTASQSRFSYLSDEGFKKMDNPKLR
FT                   RGLDKLTSSLNQIGDTFEKAFEDGRTLVENKTADIIQETRKLQTRRRGTGGEDENQNQS
FT                   YGVSSSWKKSPEQPMQLNHIEHETQLKASRDVAMATAAKAKLLLRELKTVKADLAFAKE
FT                   RCAQLEEENKHLRESHREKGSNPADEDLIRLQLESLLAEKARLAHENSVYARENRFLRE
FT                   IVEYHQLTMQDVVYIDEGSEEVTQVSPFVSTLMTSSPADRSQSPPSQEMIKEMLVVAEE
FT                   SSVCASVVSVS"
     MAYRRRQGIG KFATFKEEVD RLPPESITAV KDRSPPARSS PAFDQPRSKN FTTEPKGLWG        60
     VIAQKAKSVI EDDKSSDRST TASQSRFSYL SDEGFKKMDN PKLRRGLDKL TSSLNQIGDT       120
     FEKAFEDGRT LVENKTADII QETRKLQTRR RGTGGEDENQ NQSYGVSSSW KKSPEQPMQL       180
     NHIEHETQLK ASRDVAMATA AKAKLLLREL KTVKADLAFA KERCAQLEEE NKHLRESHRE       240
     KGSNPADEDL IRLQLESLLA EKARLAHENS VYARENRFLR EIVEYHQLTM QDVVYIDEGS       300
     EEVTQVSPFV STLMTSSPAD RSQSPPSQEM IKEMLVVAEE SSVCASVVSV S                351
//

If you have problems or comments...

PBIL Back to PBIL home page