(data stored in ACNUC13479 zone)

EMBL: CP002688.PE194

CP002688.PE194       Location/Qualifiers
FT   CDS             375542..377023
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.30"
FT                   /gene_synonym="T7H20_30"
FT                   /locus_tag="AT5G01980"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, RING-type (InterPro:IPR001841), Zinc finger, C3HC4
FT                   RING-type (InterPro:IPR018957); BEST Arabidopsis thaliana
FT                   protein match is: RING/U-box superfamily protein
FT                   (TAIR:AT5G08139.1); Has 7827 Blast hits to 7813 proteins in
FT                   270 species: Archae - 0; Bacteria - 9; Metazoa - 2445;
FT                   Fungi - 565; Plants - 3731; Viruses - 72; Other Eukaryotes
FT                   - 1005 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZN3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZN3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR260584.1,INSD:AV441319.1,INSD:AV551469.1,
FT                   INSD:DR260581.1,INSD:EL277240.1,INSD:BG459143.1,
FT                   INSD:EH878080.1,INSD:EH984701.1,INSD:DR380969.1,
FT                   INSD:ES010506.1,INSD:DR260579.1,INSD:DR260585.1,
FT                   INSD:AV562413.1,INSD:ES024013.1,INSD:CA781575.1,
FT                   INSD:EH959271.1,INSD:DR260582.1,INSD:EH802410.1,
FT                   INSD:DR260580.1,INSD:EH991196.1,INSD:BP807909.1,
FT                   INSD:ES021913.1,INSD:BP850946.1,INSD:EH826893.1,
FT                   INSD:EH877176.1,INSD:DR260583.1,INSD:EL264037.1,
FT                   INSD:EL985971.1,INSD:AV539111.1,INSD:AV442150.1,
FT                   INSD:DR242098.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK230335.1,INSD:BX832272.1,INSD:BT029027.1,
FT                   INSD:BX831675.1,INSD:AK176418.1,INSD:BT021990.1,
FT                   INSD:BX832364.1"
FT                   /protein_id="AED90416.1"
FT                   /translation="MESQGPSNGHPMDISSNSIPSSACNLCGRVVQSASDDLEIFSLCV
FT                   DCKFLLLEDFGTPAPPLARRQTIRRRRMRRRRRTTRHDSSESVGVGDLSSQQFTHLISI
FT                   ARQSLSTVQASEDLRDDLRTSSHTTPSGSTRWRLFSESESDDFDNFGETESNASFSLYR
FT                   FPHADNDTISFSAYGGESDASTDRHADIFVQPDDRSDIDFDTDIDPMRAGLNQWNSDEE
FT                   DREWEEGAGPSGVAGTRYRNYLASPSESYSSMTRFDSPELERSFRQRIIERRHSLSRNI
FT                   FTGLEDLDFSPYAANVGDYLDERGFDELLEQLAESDNSRRGAPPASVSCVRNLPRVIIA
FT                   EEHVMKGLVCAICKELFSLRNETTQLPCLHLYHAHCIVPWLSARNSCPLCRYELPTDDK
FT                   DYEEGKRNVLDVSEDSSSSDDGTESGEEEYVERGESESGVSRVSRGRWLFLAAAPVVSL
FT                   VGVVLAMWLSSPHRRGIAISHSQRENRTRRWLPFF"
     MESQGPSNGH PMDISSNSIP SSACNLCGRV VQSASDDLEI FSLCVDCKFL LLEDFGTPAP        60
     PLARRQTIRR RRMRRRRRTT RHDSSESVGV GDLSSQQFTH LISIARQSLS TVQASEDLRD       120
     DLRTSSHTTP SGSTRWRLFS ESESDDFDNF GETESNASFS LYRFPHADND TISFSAYGGE       180
     SDASTDRHAD IFVQPDDRSD IDFDTDIDPM RAGLNQWNSD EEDREWEEGA GPSGVAGTRY       240
     RNYLASPSES YSSMTRFDSP ELERSFRQRI IERRHSLSRN IFTGLEDLDF SPYAANVGDY       300
     LDERGFDELL EQLAESDNSR RGAPPASVSC VRNLPRVIIA EEHVMKGLVC AICKELFSLR       360
     NETTQLPCLH LYHAHCIVPW LSARNSCPLC RYELPTDDKD YEEGKRNVLD VSEDSSSSDD       420
     GTESGEEEYV ERGESESGVS RVSRGRWLFL AAAPVVSLVG VVLAMWLSSP HRRGIAISHS       480
     QRENRTRRWL PFF                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page