(data stored in ACNUC13479 zone)

EMBL: CP002688.PE195

CP002688.PE195       Location/Qualifiers
FT   CDS             complement(join(377373..377683,377775..377827,
FT                   377907..378007,378121..378195,378298..378528,
FT                   378830..378951,379029..379153,379232..379311,
FT                   379403..379600))
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.40"
FT                   /gene_synonym="T7H20_40"
FT                   /gene_synonym="PILS6"
FT                   /gene_synonym="PIN-LIKES 6"
FT                   /locus_tag="AT5G01990"
FT                   /product="Auxin efflux carrier family protein"
FT                   /note="Auxin efflux carrier family protein; FUNCTIONS IN:
FT                   auxin:hydrogen symporter activity; INVOLVED IN: auxin polar
FT                   transport, transmembrane transport; LOCATED IN: integral to
FT                   membrane; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Auxin
FT                   efflux carrier (InterPro:IPR004776); BEST Arabidopsis
FT                   thaliana protein match is: Auxin efflux carrier family
FT                   protein (TAIR:AT1G71090.1); Has 514 Blast hits to 486
FT                   proteins in 113 species: Archae - 2; Bacteria - 6; Metazoa
FT                   - 0; Fungi - 225; Plants - 217; Viruses - 0; Other
FT                   Eukaryotes - 64 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZN2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR039305"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZN2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL283049.1,INSD:ES072120.1,INSD:ES036133.1,
FT                   INSD:BP846668.1,INSD:BP588778.1,INSD:EL024781.1,
FT                   INSD:AU036570.1,INSD:ES021913.1,INSD:AU231077.1,
FT                   INSD:EH868614.1,INSD:ES135887.1,INSD:AU236480.1,
FT                   INSD:AU227410.1,INSD:BP842377.1,INSD:EL997047.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832768.1,INSD:BX832718.1,INSD:BT002925.1,
FT                   INSD:BX829574.1,INSD:BX829737.1"
FT                   /protein_id="AED90417.1"
FT                   /translation="MIARILAALADSMEMPVAAGGGSVLGTIKIAVMPIAKVFTMCFLG
FT                   LLMASKYVNILPPSGRKLLNGLVFSLLLPCLIFSQLGQAVTLQKMLQWWFIPVNVVLGT
FT                   ISGSIIGFIVASIVRPPYPYFKFTIIQIGVGNIGNVPLVLLAALCRDTSNPFGDSEKCS
FT                   IDGTAYISFGQWVGAIILYTYVYQMFAPPPEGFDAEEENLALKTLPVDAAPEQVPLLTQ
FT                   NFPKDFSPTQDLLPVQSTEPRGRGVSRKGKIAQIFVFLYEKLKLKQIVQPAIVASILAM
FT                   ILGAIPFTKKLIFTNGAPLFFFTDSCMILGDAMIPCILLALGGNLINGPGSSKLGFKTT
FT                   AAIIIGRLVLVPPVGLGIVTVADKLGFLPADDKMFRFVLLLQHTMPTSVLSGAVANLRG
FT                   CGRESAAVLFWVHIFAIFSMAGWMVLYINILF"
     MIARILAALA DSMEMPVAAG GGSVLGTIKI AVMPIAKVFT MCFLGLLMAS KYVNILPPSG        60
     RKLLNGLVFS LLLPCLIFSQ LGQAVTLQKM LQWWFIPVNV VLGTISGSII GFIVASIVRP       120
     PYPYFKFTII QIGVGNIGNV PLVLLAALCR DTSNPFGDSE KCSIDGTAYI SFGQWVGAII       180
     LYTYVYQMFA PPPEGFDAEE ENLALKTLPV DAAPEQVPLL TQNFPKDFSP TQDLLPVQST       240
     EPRGRGVSRK GKIAQIFVFL YEKLKLKQIV QPAIVASILA MILGAIPFTK KLIFTNGAPL       300
     FFFTDSCMIL GDAMIPCILL ALGGNLINGP GSSKLGFKTT AAIIIGRLVL VPPVGLGIVT       360
     VADKLGFLPA DDKMFRFVLL LQHTMPTSVL SGAVANLRGC GRESAAVLFW VHIFAIFSMA       420
     GWMVLYINIL F                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page