(data stored in ACNUC13479 zone)

EMBL: CP002688.PE196

CP002688.PE196       Location/Qualifiers
FT   CDS             complement(380155..380595)
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.50"
FT                   /gene_synonym="T7H20_50"
FT                   /locus_tag="AT5G02000"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 5 Blast hits to 5 proteins in 2
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 5; Viruses - 0; Other Eukaryotes - 0 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9LZN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZN1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG485119.1,INSD:EG484864.1,INSD:EG485030.1,
FT                   INSD:EG484964.1,INSD:EG484820.1,INSD:EG486656.1,
FT                   INSD:EG485042.1,INSD:EG486657.1,INSD:EG484975.1,
FT                   INSD:EG485097.1,INSD:EG486658.1,INSD:EG484875.1,
FT                   INSD:EG486659.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ132718.1"
FT                   /protein_id="AED90418.1"
FT                   /translation="MENEVGWMNEASKDSSNNGESFIEIQINKAVRTTGLSISSSPSPE
FT                   NEMQTTTAIFSSATSCFSAYSSVTRLMMKVGCLSIVGVIREKVNVGERWVLQVIQRRRN
FT                   KSPLRYYYEGSMSNNKDEALTDDSLKAAIAYCNASSLSPLQT"
     MENEVGWMNE ASKDSSNNGE SFIEIQINKA VRTTGLSISS SPSPENEMQT TTAIFSSATS        60
     CFSAYSSVTR LMMKVGCLSI VGVIREKVNV GERWVLQVIQ RRRNKSPLRY YYEGSMSNNK       120
     DEALTDDSLK AAIAYCNASS LSPLQT                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page