(data stored in ACNUC13479 zone)

EMBL: CP002688.PE2

CP002688.PE2         Location/Qualifiers
FT   CDS             complement(join(1388..1459,1572..1646,1745..1780,
FT                   1914..1961,2435..2509,2748..2799,2872..2934,3303..3383,
FT                   3543..3659,3762..3802,3927..4005,4102..4258,4335..4467,
FT                   4552..4679,4765..4924))
FT                   /codon_start=1
FT                   /gene_synonym="TOPTELOMERE.1"
FT                   /gene_synonym="TOPTELOMERE_1"
FT                   /locus_tag="AT5G01010"
FT                   /product="retinal-binding protein"
FT                   /note="CONTAINS InterPro DOMAIN/s: GOLD
FT                   (InterPro:IPR009038); Has 172 Blast hits to 172 proteins in
FT                   43 species: Archae - 0; Bacteria - 0; Metazoa - 95; Fungi -
FT                   0; Plants - 63; Viruses - 0; Other Eukaryotes - 14 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01010"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GSG8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR187260.1,INSD:BP826070.1,INSD:BP651478.1,
FT                   INSD:ES212707.1,INSD:BP646711.1,INSD:AA650929.1,
FT                   INSD:DR187262.1,INSD:Z37634.1,INSD:BP647136.1,
FT                   INSD:BP644726.1,INSD:BP651250.1,INSD:BP815799.1,
FT                   INSD:BP847683.1,INSD:DR187269.1,INSD:ES124603.1,
FT                   INSD:BP568621.1,INSD:AV519354.1,INSD:BP825768.1,
FT                   INSD:BP812360.2,INSD:BP584701.1,INSD:AA395636.1,
FT                   INSD:BP589164.1,INSD:BP846130.1,INSD:BP617571.1,
FT                   INSD:EH866827.1,INSD:BP835033.1,INSD:ES206247.1,
FT                   INSD:BP821517.1,INSD:BP636036.1,INSD:DR187265.1,
FT                   INSD:EL123288.1,INSD:BP669855.1,INSD:BP575092.1,
FT                   INSD:BP580018.1,INSD:DR187259.1,INSD:ES056933.1,
FT                   INSD:BP796965.1,INSD:BP584957.1,INSD:BP647818.1,
FT                   INSD:BP827398.1,INSD:EL033065.1,INSD:BP596440.1,
FT                   INSD:DR187268.1,INSD:BP655610.1,INSD:BP593388.1,
FT                   INSD:DR187271.1,INSD:BP826832.1,INSD:BP579382.1,
FT                   INSD:EL093261.1,INSD:EH912904.1,INSD:BP570833.1,
FT                   INSD:CF773050.1,INSD:EL995855.1,INSD:ES113294.1,
FT                   INSD:BP800752.1,INSD:BP867737.1,INSD:ES214429.1,
FT                   INSD:AU230908.1,INSD:DR187275.1,INSD:EH965517.1,
FT                   INSD:EL220721.1,INSD:AU230514.1,INSD:EL219028.1,
FT                   INSD:BP575248.1,INSD:EG492058.1,INSD:DR187266.1,
FT                   INSD:BP814352.2,INSD:BP660278.1,INSD:DR187267.1,
FT                   INSD:DR187273.1,INSD:BU635629.1,INSD:BP823082.1,
FT                   INSD:BP828812.1,INSD:ES181058.1,INSD:EH956632.1,
FT                   INSD:DR187272.1,INSD:ES052436.1,INSD:AU239579.1,
FT                   INSD:BP812340.1,INSD:EL321475.1,INSD:DR376054.1,
FT                   INSD:BP576423.1,INSD:T21323.1,INSD:BP570885.1,
FT                   INSD:BP639794.1,INSD:ES065956.1,INSD:BP841170.1,
FT                   INSD:BP800313.1,INSD:BP823070.1,INSD:EL166424.1,
FT                   INSD:EL291281.1,INSD:BP567984.1,INSD:EL184120.1,
FT                   INSD:BP581973.1,INSD:BP597853.1,INSD:DR187270.1,
FT                   INSD:BP836409.1,INSD:DR378517.1,INSD:BP828424.1,
FT                   INSD:BP818936.1,INSD:ES029939.1,INSD:AV783961.1,
FT                   INSD:BP627961.1,INSD:BP815149.1,INSD:BP653553.1,
FT                   INSD:BP616535.1,INSD:ES081715.1,INSD:EL088227.1,
FT                   INSD:DR211921.1,INSD:BP581797.1,INSD:ES009815.1,
FT                   INSD:AV810411.1,INSD:BP568863.1,INSD:EH937758.1,
FT                   INSD:BP596113.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK175954.1,INSD:AK175870.1,INSD:AK176023.1,
FT                   INSD:AK175670.1,INSD:AK176242.1,INSD:AK175634.1,
FT                   INSD:AK175582.1,INSD:AK175776.1,INSD:AK175802.1,
FT                   INSD:BX841661.1,INSD:AK175790.1,INSD:AK176336.1,
FT                   INSD:AK118711.1,INSD:AK176647.1,INSD:AK175920.1,
FT                   INSD:AK176058.1,INSD:AK176164.1,INSD:AK175953.1,
FT                   INSD:AK175380.1,INSD:AK176250.1,INSD:AK176507.1,
FT                   INSD:AK118368.1,INSD:AK176004.1,INSD:AK176009.1,
FT                   INSD:BX830051.1,INSD:AK175538.1,INSD:AK176260.1,
FT                   INSD:AK176032.1,INSD:AK176045.1,INSD:AK175763.1"
FT                   /protein_id="AED90282.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTVMTYMPQDFRGTLIRQQKERSER
FT                   NKQAEVDALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLL
FT                   DFIRQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLS
FT                   EAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISL
FT                   MVESENSYIAWDFSLMQGKISMDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAG
FT                   NYKLVWDNSYSTFFKKTLRYKVDCIAPVVEPDPEPEPLN"
     MASTEGLMPI TRAFLASYYD KYPFSPLSDD VSRLSSDMAS LIKLLTVQSP PSQGETSLID        60
     EANRQPPHKI DENMWKNREQ MEEILFLLSP SRWPVQLREP STSEDAEFAS ILRTLKDSFD       120
     NAFTAMISFQ TKNSERIFST VMTYMPQDFR GTLIRQQKER SERNKQAEVD ALVSSGGSIR       180
     DTYALLWKQQ MERRRQLAQL GSATGVYKTL VKYLVGVPQV LLDFIRQIND DDGPMEEQRE       240
     RYGPPLYSLT KMVIAIRVFL TLLWERYDTF KLSKDQMNLL SEAAIVYTSE FERFVTFISD       300
     VFANSPFFIS ADTAGILWSR DNEEYKEIIV QAGRTYEISL MVESENSYIA WDFSLMQGKI       360
     SMDIGFSVEY INASGEKTLI LPYRRYEADQ GNFSTLMAGN YKLVWDNSYS TFFKKTLRYK       420
     VDCIAPVVEP DPEPEPLN                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page