(data stored in ACNUC13479 zone)

EMBL: CP002688.PE20

CP002688.PE20        Location/Qualifiers
FT   CDS             complement(28532..29086)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.60"
FT                   /gene_synonym="F7J8_60"
FT                   /locus_tag="AT5G01080"
FT                   /product="Beta-galactosidase related protein"
FT                   /note="Beta-galactosidase related protein; FUNCTIONS IN:
FT                   hydrolase activity, hydrolyzing O-glycosyl compounds;
FT                   INVOLVED IN: carbohydrate metabolic process; CONTAINS
FT                   InterPro DOMAIN/s: Glycoside hydrolase, family 35
FT                   (InterPro:IPR001944); BEST Arabidopsis thaliana protein
FT                   match is: Beta-galactosidase related protein
FT                   (TAIR:AT5G35760.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01080"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01080.1"
FT                   /db_xref="GOA:F4K7X9"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7X9"
FT                   /inference="similar to RNA sequence, EST:INSD:ES063959.1"
FT                   /protein_id="AED90297.1"
FT                   /translation="MLLCWYNYISRTLPFEAPREIFHKTKRVKKNGTMIPSPQSGDYRS
FT                   FFNSSSPLPLIIELVHVQIIKFKDSSQIFKSLKKNGIITAFPWKSGYRSILNLFYPTAS
FT                   SLEFVSKSLYALFARAVYDHPLVEDFAKLVFMVESAIVSTDFSTIANFLKVNIPLENSW
FT                   NLYLSFCCIIVACINFPLLRP"
     MLLCWYNYIS RTLPFEAPRE IFHKTKRVKK NGTMIPSPQS GDYRSFFNSS SPLPLIIELV        60
     HVQIIKFKDS SQIFKSLKKN GIITAFPWKS GYRSILNLFY PTASSLEFVS KSLYALFARA       120
     VYDHPLVEDF AKLVFMVESA IVSTDFSTIA NFLKVNIPLE NSWNLYLSFC CIIVACINFP       180
     LLRP                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page