(data stored in ACNUC13479 zone)

EMBL: CP002688.PE21

CP002688.PE21        Location/Qualifiers
FT   CDS             33055..34116
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.70"
FT                   /gene_synonym="F7J8_70"
FT                   /locus_tag="AT5G01090"
FT                   /product="Concanavalin A-like lectin family protein"
FT                   /note="Concanavalin A-like lectin family protein; FUNCTIONS
FT                   IN: carbohydrate binding, binding; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: endomembrane
FT                   system; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Legume lectin, beta chain (InterPro:IPR001220),
FT                   Concanavalin A-like lectin/glucanase, subgroup
FT                   (InterPro:IPR013320), Concanavalin A-like lectin/glucanase
FT                   (InterPro:IPR008985); BEST Arabidopsis thaliana protein
FT                   match is: Concanavalin A-like lectin family protein
FT                   (TAIR:AT3G09190.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFC7"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CB259122.1,INSD:EL254872.1,INSD:ES181783.1,
FT                   INSD:EL999500.1,INSD:BP779861.1,INSD:ES102589.1,
FT                   INSD:ES059209.1,INSD:AU227487.1,INSD:EL115606.1,
FT                   INSD:ES060963.1,INSD:ES194348.1,INSD:EL138001.1,
FT                   INSD:ES095586.1,INSD:ES130862.1,INSD:CB259782.1,
FT                   INSD:BP659977.1,INSD:EH968387.1,INSD:ES171696.1,
FT                   INSD:EL200584.1,INSD:BP661371.1,INSD:BP593608.1,
FT                   INSD:AU236536.1,INSD:ES110178.1,INSD:ES009620.1,
FT                   INSD:EL200793.1,INSD:ES214075.1,INSD:DR376811.1,
FT                   INSD:AV557596.1,INSD:ES050811.1,INSD:EH798333.1,
FT                   INSD:BP860691.1,INSD:EL246126.1,INSD:T45244.1,
FT                   INSD:ES181749.1,INSD:EH854912.1,INSD:EH910126.1,
FT                   INSD:F13962.1,INSD:BP841481.1,INSD:BP640127.1,
FT                   INSD:ES176887.1,INSD:ES094966.1,INSD:ES089834.1,
FT                   INSD:F14046.1,INSD:EL985127.1,INSD:EL970808.1,
FT                   INSD:EL098094.1,INSD:AV534557.1,INSD:EH814314.1,
FT                   INSD:EL105261.1,INSD:ES097721.1,INSD:ES191355.1,
FT                   INSD:ES151590.1,INSD:DR231932.1,INSD:T45690.1,
FT                   INSD:EL010969.1,INSD:BP829595.1,INSD:EL160234.1,
FT                   INSD:EL992313.1,INSD:EL312062.1,INSD:ES041377.1,
FT                   INSD:ES038430.1,INSD:BP827058.1,INSD:DR231933.1,
FT                   INSD:ES108134.1,INSD:EG439761.1,INSD:BP588343.1,
FT                   INSD:BP821480.1,INSD:ES074194.1,INSD:EH983067.1,
FT                   INSD:EL267397.1,INSD:EH802366.1,INSD:ES018470.1,
FT                   INSD:EL984625.1,INSD:ES093387.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832720.1,INSD:AY088097.1,INSD:BX832388.1,
FT                   INSD:BX832299.1,INSD:AK228471.1,INSD:BX829725.1"
FT                   /protein_id="AED90298.1"
FT                   /translation="MAVFKTLAFLFVLSIVIYQSVAVTDVNSSFSFNGFVKAPSFDNNV
FT                   ALFGDSKLVHGGPSIQLTDSVSRSEGRVIYKKPIRLFQGKERNFSGSFSTSFSFSMSDE
FT                   IGSVLAFIMVPRGLDLRLFGRKGNNSSSGLGFLLKHKVVAVEFGISKRGNHVGILVGRP
FT                   ESGKVRKLSSFGHHFNEEKRLNCWIDYEASSKRIEVRLSLSAALKPVDPFVSYSVDLAK
FT                   LWKDGKFMVGLTSANGNTSKPVYLHSWSFKLRHPSMRIHSQPLDPNDVSKTVKEGEKTV
FT                   EVKGKGKCIWRILGALVLGAVCGTLGAMFALYLWTICGNRQSMAIVPEECADEKADILV
FT                   TKADVVVEEEVKK"
     MAVFKTLAFL FVLSIVIYQS VAVTDVNSSF SFNGFVKAPS FDNNVALFGD SKLVHGGPSI        60
     QLTDSVSRSE GRVIYKKPIR LFQGKERNFS GSFSTSFSFS MSDEIGSVLA FIMVPRGLDL       120
     RLFGRKGNNS SSGLGFLLKH KVVAVEFGIS KRGNHVGILV GRPESGKVRK LSSFGHHFNE       180
     EKRLNCWIDY EASSKRIEVR LSLSAALKPV DPFVSYSVDL AKLWKDGKFM VGLTSANGNT       240
     SKPVYLHSWS FKLRHPSMRI HSQPLDPNDV SKTVKEGEKT VEVKGKGKCI WRILGALVLG       300
     AVCGTLGAMF ALYLWTICGN RQSMAIVPEE CADEKADILV TKADVVVEEE VKK              353
//

If you have problems or comments...

PBIL Back to PBIL home page