(data stored in ACNUC13479 zone)

EMBL: CP002688.PE23

CP002688.PE23        Location/Qualifiers
FT   CDS             complement(42114..44387)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.90"
FT                   /gene_synonym="F7J8_90"
FT                   /locus_tag="AT5G01110"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01110"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BGD3"
FT                   /protein_id="ANM70669.1"
FT                   /translation="MNQTTVKVFKFQFLFSIEIKLSLSQPQKMIVHRIIPSRVKDPLTR
FT                   FKPLKNLTTSSSPVFEPSSSSSSSSSSASFSVSDSFLVEKICFSLKQGNNNVRNHLIRL
FT                   NPLAVVEVLYRCRNDLTLGQRFVDQLGFHFPNFKHTSLSLSAMIHILVRSGRLSDAQSC
FT                   LLRMIRRSGVSRLEIVNSLDSTFSNCGSNDSVFDLLIRTYVQARKLREAHEAFTLLRSK
FT                   GFTVSIDACNALIGSLVRIGWVELAWGVYQEISRSGVGINVYTLNIMVNALCKDGKMEK
FT                   VGTFLSQVQEKGVYPDIVTYNTLISAYSSKGLMEEAFELMNAMPGKGFSPGVYTYNTVI
FT                   NGLCKHGKYERAKEVFAEMLRSGLSPDSTTYRSLLMEACKKGDVVETEKVFSDMRSRDV
FT                   VPDLVCFSSMMSLFTRSGNLDKALMYFNSVKEAGLIPDNVIYTILIQGYCRKGMISVAM
FT                   NLRNEMLQQGCAMDVVTYNTILHGLCKRKMLGEADKLFNEMTERALFPDSYTLTILIDG
FT                   HCKLGNLQNAMELFQKMKEKRIRLDVVTYNTLLDGFGKVGDIDTAKEIWADMVSKEILP
FT                   TPISYSILVNALCSKGHLAEAFRVWDEMISKNIKPTVMICNSMIKGYCRSGNASDGESF
FT                   LEKMISEGFVPDCISYNTLIYGFVREENMSKAFGLVKKMEEEQGGLVPDVFTYNSILHG
FT                   FCRQNQMKEAEVVLRKMIERGVNPDRSTYTCMINGFVSQDNLTEAFRIHDEMLQRGFSP
FT                   DDKF"
     MNQTTVKVFK FQFLFSIEIK LSLSQPQKMI VHRIIPSRVK DPLTRFKPLK NLTTSSSPVF        60
     EPSSSSSSSS SSASFSVSDS FLVEKICFSL KQGNNNVRNH LIRLNPLAVV EVLYRCRNDL       120
     TLGQRFVDQL GFHFPNFKHT SLSLSAMIHI LVRSGRLSDA QSCLLRMIRR SGVSRLEIVN       180
     SLDSTFSNCG SNDSVFDLLI RTYVQARKLR EAHEAFTLLR SKGFTVSIDA CNALIGSLVR       240
     IGWVELAWGV YQEISRSGVG INVYTLNIMV NALCKDGKME KVGTFLSQVQ EKGVYPDIVT       300
     YNTLISAYSS KGLMEEAFEL MNAMPGKGFS PGVYTYNTVI NGLCKHGKYE RAKEVFAEML       360
     RSGLSPDSTT YRSLLMEACK KGDVVETEKV FSDMRSRDVV PDLVCFSSMM SLFTRSGNLD       420
     KALMYFNSVK EAGLIPDNVI YTILIQGYCR KGMISVAMNL RNEMLQQGCA MDVVTYNTIL       480
     HGLCKRKMLG EADKLFNEMT ERALFPDSYT LTILIDGHCK LGNLQNAMEL FQKMKEKRIR       540
     LDVVTYNTLL DGFGKVGDID TAKEIWADMV SKEILPTPIS YSILVNALCS KGHLAEAFRV       600
     WDEMISKNIK PTVMICNSMI KGYCRSGNAS DGESFLEKMI SEGFVPDCIS YNTLIYGFVR       660
     EENMSKAFGL VKKMEEEQGG LVPDVFTYNS ILHGFCRQNQ MKEAEVVLRK MIERGVNPDR       720
     STYTCMINGF VSQDNLTEAF RIHDEMLQRG FSPDDKF                                757
//

If you have problems or comments...

PBIL Back to PBIL home page