(data stored in ACNUC13479 zone)

EMBL: CP002688.PE24

CP002688.PE24        Location/Qualifiers
FT   CDS             complement(42114..44303)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.90"
FT                   /gene_synonym="F7J8_90"
FT                   /locus_tag="AT5G01110"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /note="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein; LOCATED IN: chloroplast; CONTAINS InterPro
FT                   DOMAIN/s: Pentatricopeptide repeat (InterPro:IPR002885);
FT                   BEST Arabidopsis thaliana protein match is:
FT                   Pentatricopeptide repeat (PPR-like) superfamily protein
FT                   (TAIR:AT1G05670.2); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01110"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU227497.1,INSD:AU236546.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK228473.1,INSD:BT005783.1"
FT                   /protein_id="AED90300.1"
FT                   /translation="MIVHRIIPSRVKDPLTRFKPLKNLTTSSSPVFEPSSSSSSSSSSA
FT                   SFSVSDSFLVEKICFSLKQGNNNVRNHLIRLNPLAVVEVLYRCRNDLTLGQRFVDQLGF
FT                   HFPNFKHTSLSLSAMIHILVRSGRLSDAQSCLLRMIRRSGVSRLEIVNSLDSTFSNCGS
FT                   NDSVFDLLIRTYVQARKLREAHEAFTLLRSKGFTVSIDACNALIGSLVRIGWVELAWGV
FT                   YQEISRSGVGINVYTLNIMVNALCKDGKMEKVGTFLSQVQEKGVYPDIVTYNTLISAYS
FT                   SKGLMEEAFELMNAMPGKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEMLRSGLSPDS
FT                   TTYRSLLMEACKKGDVVETEKVFSDMRSRDVVPDLVCFSSMMSLFTRSGNLDKALMYFN
FT                   SVKEAGLIPDNVIYTILIQGYCRKGMISVAMNLRNEMLQQGCAMDVVTYNTILHGLCKR
FT                   KMLGEADKLFNEMTERALFPDSYTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVT
FT                   YNTLLDGFGKVGDIDTAKEIWADMVSKEILPTPISYSILVNALCSKGHLAEAFRVWDEM
FT                   ISKNIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVREEN
FT                   MSKAFGLVKKMEEEQGGLVPDVFTYNSILHGFCRQNQMKEAEVVLRKMIERGVNPDRST
FT                   YTCMINGFVSQDNLTEAFRIHDEMLQRGFSPDDKF"
     MIVHRIIPSR VKDPLTRFKP LKNLTTSSSP VFEPSSSSSS SSSSASFSVS DSFLVEKICF        60
     SLKQGNNNVR NHLIRLNPLA VVEVLYRCRN DLTLGQRFVD QLGFHFPNFK HTSLSLSAMI       120
     HILVRSGRLS DAQSCLLRMI RRSGVSRLEI VNSLDSTFSN CGSNDSVFDL LIRTYVQARK       180
     LREAHEAFTL LRSKGFTVSI DACNALIGSL VRIGWVELAW GVYQEISRSG VGINVYTLNI       240
     MVNALCKDGK MEKVGTFLSQ VQEKGVYPDI VTYNTLISAY SSKGLMEEAF ELMNAMPGKG       300
     FSPGVYTYNT VINGLCKHGK YERAKEVFAE MLRSGLSPDS TTYRSLLMEA CKKGDVVETE       360
     KVFSDMRSRD VVPDLVCFSS MMSLFTRSGN LDKALMYFNS VKEAGLIPDN VIYTILIQGY       420
     CRKGMISVAM NLRNEMLQQG CAMDVVTYNT ILHGLCKRKM LGEADKLFNE MTERALFPDS       480
     YTLTILIDGH CKLGNLQNAM ELFQKMKEKR IRLDVVTYNT LLDGFGKVGD IDTAKEIWAD       540
     MVSKEILPTP ISYSILVNAL CSKGHLAEAF RVWDEMISKN IKPTVMICNS MIKGYCRSGN       600
     ASDGESFLEK MISEGFVPDC ISYNTLIYGF VREENMSKAF GLVKKMEEEQ GGLVPDVFTY       660
     NSILHGFCRQ NQMKEAEVVL RKMIERGVNP DRSTYTCMIN GFVSQDNLTE AFRIHDEMLQ       720
     RGFSPDDKF                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page