(data stored in ACNUC13479 zone)

EMBL: CP002688.PE25

CP002688.PE25        Location/Qualifiers
FT   CDS             join(45281..45928,46012..46761,46852..46986)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.100"
FT                   /gene_synonym="F7J8_100"
FT                   /locus_tag="AT5G01120"
FT                   /product="hypothetical protein (DUF674)"
FT                   /note="Protein of unknown function (DUF674); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF674
FT                   (InterPro:IPR007750); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF674)
FT                   (TAIR:AT5G43240.3); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01120"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG448915.1,INSD:EG448885.1,INSD:EG448928.1,
FT                   INSD:EG448920.1,INSD:EG448918.1,INSD:EG448914.1,
FT                   INSD:EG448916.1,INSD:EG448884.1,INSD:EG448927.1,
FT                   INSD:EG448917.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY735669.1"
FT                   /protein_id="AED90301.1"
FT                   /translation="MSDDFENSVINLKLLIDEEKNKVVFAEAGTDFVDILFSFSTLPMG
FT                   TIVRLLEMHHKSRSIAIGCFNNIYASVVSMGMKHFSTQACKQMLLFPGSLNQDKCQNMK
FT                   LKIDDSEATKCFMCPMFVRSGQCSKGYSNFKTSRCSCGNFMDEVIQFQGEGGRGNGSQA
FT                   EVFVRGAHTSFIITDDLKVQVNSVGSTLNVLKDLAYADCDKLVEMILEVNLQEVATLLV
FT                   CLFTSDTPLTDTFLKKKSSHGMNRIHKRPSPSLSEDREETKADQTIMLNAYVRKEEGNI
FT                   LYVECGDDFVDLLFSFLAMPLESVWDISGRGIILGCIGNLCKSFKDLSSASATEASAFK
FT                   CVLPHYYKCQKQLLNDVVTTHQPPTYYRFVSFSADHFREYRLSENSGKRLVYDWDKLVP
FT                   VTSIDPKTEGNNTAETSGFVKRGTKFMVTDDLIINPSNSTSTIGFLKEKQTRLDEVEIR
FT                   VINMTKEEAIRLLGASMVTSSALSTGLLAMESASTSDPKCRFFKKPKIETET"
     MSDDFENSVI NLKLLIDEEK NKVVFAEAGT DFVDILFSFS TLPMGTIVRL LEMHHKSRSI        60
     AIGCFNNIYA SVVSMGMKHF STQACKQMLL FPGSLNQDKC QNMKLKIDDS EATKCFMCPM       120
     FVRSGQCSKG YSNFKTSRCS CGNFMDEVIQ FQGEGGRGNG SQAEVFVRGA HTSFIITDDL       180
     KVQVNSVGST LNVLKDLAYA DCDKLVEMIL EVNLQEVATL LVCLFTSDTP LTDTFLKKKS       240
     SHGMNRIHKR PSPSLSEDRE ETKADQTIML NAYVRKEEGN ILYVECGDDF VDLLFSFLAM       300
     PLESVWDISG RGIILGCIGN LCKSFKDLSS ASATEASAFK CVLPHYYKCQ KQLLNDVVTT       360
     HQPPTYYRFV SFSADHFREY RLSENSGKRL VYDWDKLVPV TSIDPKTEGN NTAETSGFVK       420
     RGTKFMVTDD LIINPSNSTS TIGFLKEKQT RLDEVEIRVI NMTKEEAIRL LGASMVTSSA       480
     LSTGLLAMES ASTSDPKCRF FKKPKIETET                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page