(data stored in ACNUC13479 zone)

EMBL: CP002688.PE26

CP002688.PE26        Location/Qualifiers
FT   CDS             join(47642..48253,48355..49005,49079..49174)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.110"
FT                   /gene_synonym="F7J8_110"
FT                   /locus_tag="AT5G01130"
FT                   /product="hypothetical protein (DUF674)"
FT                   /note="Protein of unknown function (DUF674); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF674
FT                   (InterPro:IPR007750); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF674)
FT                   (TAIR:AT5G01150.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01130"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7Y4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG492395.1,INSD:EG524343.1,INSD:EG523695.1,
FT                   INSD:EG523704.1,INSD:EG523703.1,INSD:EG492399.1,
FT                   INSD:EG492400.1,INSD:EG524354.1,INSD:EG524346.1,
FT                   INSD:EG524352.1,INSD:EG524340.1,INSD:EG523699.1,
FT                   INSD:EG429963.1,INSD:EG523697.1,INSD:EG492397.1,
FT                   INSD:EG492402.1,INSD:EG524338.1,INSD:EG492398.1,
FT                   INSD:EG492403.1,INSD:EG524357.1,INSD:EG523694.1,
FT                   INSD:EG523696.1,INSD:EG523691.1,INSD:EG524341.1,
FT                   INSD:EG523693.1,INSD:EG524339.1,INSD:EG524355.1,
FT                   INSD:EG523692.1,INSD:EG523643.1,INSD:EG524353.1,
FT                   INSD:EG492394.1,INSD:EG524342.1,INSD:EG524347.1,
FT                   INSD:EG492393.1,INSD:EG492401.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ653258.1"
FT                   /protein_id="AED90302.1"
FT                   /translation="MAESSEEPKVSLRLFIDEEKNKVVLAEASKAFVDVLFSLLTLPMG
FT                   TIIRLLEEHRESQPITVGCFSNLYRSVAEMGIDNFKTDVCKHILLHPRSVRDLQYKRLM
FT                   LNINPTEVKLFKCPISCNFYSHFSTSRCQCGSSMNKEFQEPRVVPVASSIQNDVNGVFI
FT                   ITDDLKVAVRSTDVVLNELKSLGSGDISKLREMLVYIGFEEVLTLLECMFSSKAPLTNT
FT                   FLNKQTFQGQGVTKVYETLSPCMETNGDTFLTLDVIVRKQDMEILYVECGEDFVDLLFT
FT                   FLAVPLEYVVGISGNSCSFVCIRNLIRSFKDLNAAEVSTSKSAIHHFYTCQKQLLNIIT
FT                   DQPPLYHRYNYYSLKECSGSTPLILIDPEGSGFVKRETKFTVSDDLIVTAMNSSSPICL
FT                   LQKFQIHADDLEVQQISTSKTEATSLLRASLVTSSALKTSLRNLILKNPEEEI"
     MAESSEEPKV SLRLFIDEEK NKVVLAEASK AFVDVLFSLL TLPMGTIIRL LEEHRESQPI        60
     TVGCFSNLYR SVAEMGIDNF KTDVCKHILL HPRSVRDLQY KRLMLNINPT EVKLFKCPIS       120
     CNFYSHFSTS RCQCGSSMNK EFQEPRVVPV ASSIQNDVNG VFIITDDLKV AVRSTDVVLN       180
     ELKSLGSGDI SKLREMLVYI GFEEVLTLLE CMFSSKAPLT NTFLNKQTFQ GQGVTKVYET       240
     LSPCMETNGD TFLTLDVIVR KQDMEILYVE CGEDFVDLLF TFLAVPLEYV VGISGNSCSF       300
     VCIRNLIRSF KDLNAAEVST SKSAIHHFYT CQKQLLNIIT DQPPLYHRYN YYSLKECSGS       360
     TPLILIDPEG SGFVKRETKF TVSDDLIVTA MNSSSPICLL QKFQIHADDL EVQQISTSKT       420
     EATSLLRASL VTSSALKTSL RNLILKNPEE EI                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page