(data stored in ACNUC13479 zone)

EMBL: CP002688.PE27

CP002688.PE27        Location/Qualifiers
FT   CDS             join(49891..49975,50024..51222,51300..51437)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.120"
FT                   /gene_synonym="F7J8_120"
FT                   /locus_tag="AT5G01140"
FT                   /product="hypothetical protein (DUF674)"
FT                   /note="Protein of unknown function (DUF674); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF674
FT                   (InterPro:IPR007750); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF674)
FT                   (TAIR:AT5G01150.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC2"
FT                   /protein_id="AED90303.1"
FT                   /translation="MAQSSTEPKFSLRLIIDEEKNKVVLAEAGTIVRLLAKHRKSDPVT
FT                   IGCLRNLYTSVVDMELDDFETDACKQMLLYPKNIREAQYRNFKLNIDTNESLKCFGCRF
FT                   FSICRMCSNFNTSLCKCGKLMNEEISFLEYEENDVEGVFMRDKSSFIITDDLRLTDDST
FT                   SSLLQTLKDLGCADVSKLREQVLDIGLKEVMTLMQCVFTSNTPLTDAFLKNQSSNTVRK
FT                   IYRKLSDDKGDEAEPDKVITIDAIVRKQDMKILYVECGEDFVDLLFTFLAIPLESIWEI
FT                   SGNSITIGRIGNLFRSFKDLSDNEVLSASKCMIPYYYRCQKQLLKIRTPTPRVYLGHCY
FT                   SKTLSYSQSFYLTTKRTTKRMTFVDPKSDCCGRSKDGKGFVKRGTKFIVSDDLIVTPKI
FT                   SSSTFSVLKKFQILTDDLEVQAITISNADALNLLGASLVTSSALSSAFGNLIVKKPKEE
FT                   NVSWNPVSKKPKVET"
     MAQSSTEPKF SLRLIIDEEK NKVVLAEAGT IVRLLAKHRK SDPVTIGCLR NLYTSVVDME        60
     LDDFETDACK QMLLYPKNIR EAQYRNFKLN IDTNESLKCF GCRFFSICRM CSNFNTSLCK       120
     CGKLMNEEIS FLEYEENDVE GVFMRDKSSF IITDDLRLTD DSTSSLLQTL KDLGCADVSK       180
     LREQVLDIGL KEVMTLMQCV FTSNTPLTDA FLKNQSSNTV RKIYRKLSDD KGDEAEPDKV       240
     ITIDAIVRKQ DMKILYVECG EDFVDLLFTF LAIPLESIWE ISGNSITIGR IGNLFRSFKD       300
     LSDNEVLSAS KCMIPYYYRC QKQLLKIRTP TPRVYLGHCY SKTLSYSQSF YLTTKRTTKR       360
     MTFVDPKSDC CGRSKDGKGF VKRGTKFIVS DDLIVTPKIS SSTFSVLKKF QILTDDLEVQ       420
     AITISNADAL NLLGASLVTS SALSSAFGNL IVKKPKEENV SWNPVSKKPK VET              473
//

If you have problems or comments...

PBIL Back to PBIL home page