(data stored in ACNUC13479 zone)

EMBL: CP002688.PE28

CP002688.PE28        Location/Qualifiers
FT   CDS             join(51988..52623,52708..53439,53512..53649)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.130"
FT                   /gene_synonym="F7J8_130"
FT                   /locus_tag="AT5G01150"
FT                   /product="hypothetical protein (DUF674)"
FT                   /note="Protein of unknown function (DUF674); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF674
FT                   (InterPro:IPR007750); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF674)
FT                   (TAIR:AT5G01130.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01150"
FT                   /db_xref="GOA:Q9LFC1"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG523726.1,INSD:EG523718.1,INSD:EG523729.1,
FT                   INSD:EG469454.1,INSD:EG523720.1,INSD:EG523730.1,
FT                   INSD:EG523724.1,INSD:EG523701.1,INSD:EG523721.1,
FT                   INSD:EG523731.1,INSD:EG523728.1,INSD:EG523702.1,
FT                   INSD:EG523723.1,INSD:EG523719.1,INSD:EG469453.1,
FT                   INSD:EG523727.1,INSD:EG523725.1"
FT                   /protein_id="AED90304.1"
FT                   /translation="MAKSSEEPKFSLRLIVDEEKNKVVLAEACRDFVDVLFSLLTLPMG
FT                   TIVRLLENHRKSEPVTLGCFNNLYRSVVDMGSDCFETEACKQMLVYPKSVKDLQCKRLK
FT                   LNINPTEDIKCFKCSSYCGLYSNFSTSKCRCGKFMNEEIQLENEEQDLGRFQDDDNGVF
FT                   VSGRCSFVLTDDLEVSVKSTELVLNKLKSLGCADVGKLGERLLDIGVKEVLTLLGCIFS
FT                   SNAPLKDIFLNKKITQGATKFYKSQSPCLEKKEDEAEPEKVVTLKAFVRKQDMKILFVE
FT                   CGEEFVELLFSFIAVPLESAWEISGSSISLGCIGNMCRTFRDLNEETQMSTSTCALPSF
FT                   YNFQMQLPGIITQQPPVYYRYRLYDYRQMNYGLTTNGNRTTYYRKDRIVRVDLKDPKSR
FT                   GSDKSAQGFLKKATKCTVLDDLTITSMNSCSTVCLLKKLQSHADDLEVQVISISNAEAL
FT                   DLLRASLVTSSALSTTLWNLIAKKLKEETDLWDTVSKKVKEET"
     MAKSSEEPKF SLRLIVDEEK NKVVLAEACR DFVDVLFSLL TLPMGTIVRL LENHRKSEPV        60
     TLGCFNNLYR SVVDMGSDCF ETEACKQMLV YPKSVKDLQC KRLKLNINPT EDIKCFKCSS       120
     YCGLYSNFST SKCRCGKFMN EEIQLENEEQ DLGRFQDDDN GVFVSGRCSF VLTDDLEVSV       180
     KSTELVLNKL KSLGCADVGK LGERLLDIGV KEVLTLLGCI FSSNAPLKDI FLNKKITQGA       240
     TKFYKSQSPC LEKKEDEAEP EKVVTLKAFV RKQDMKILFV ECGEEFVELL FSFIAVPLES       300
     AWEISGSSIS LGCIGNMCRT FRDLNEETQM STSTCALPSF YNFQMQLPGI ITQQPPVYYR       360
     YRLYDYRQMN YGLTTNGNRT TYYRKDRIVR VDLKDPKSRG SDKSAQGFLK KATKCTVLDD       420
     LTITSMNSCS TVCLLKKLQS HADDLEVQVI SISNAEALDL LRASLVTSSA LSTTLWNLIA       480
     KKLKEETDLW DTVSKKVKEE T                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page