(data stored in ACNUC13479 zone)

EMBL: CP002688.PE29

CP002688.PE29        Location/Qualifiers
FT   CDS             join(54280..54534,54657..54715,54959..55727)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.140"
FT                   /gene_synonym="F7J8_140"
FT                   /locus_tag="AT5G01160"
FT                   /product="RING/U-box superfamily protein"
FT                   /db_xref="GOA:Q9LFC0"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR040380"
FT                   /db_xref="InterPro:IPR040383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC0"
FT                   /protein_id="ANM69516.1"
FT                   /translation="MLQIRLRRDSPTETGNGARPSPTETVTVACPDHLVLADLPVAKGI
FT                   GSVTPTTVIKPVGRRSRRQLGERVHFCVRCDFPIAIYGRLIPCDHAFCLECARSDSICY
FT                   LCDERIQKIQTIKMMEGIFICAAPHCLRSFLKKLDFEAHVHDLHGSLLQADAEKEDGNQ
FT                   SDVQSTMQQSSASESTLRAPLRSQLQQSRELNRSASFAKSQSGFSQVQNYPPDSDNSRP
FT                   PGFETASPKPGIRFPDYPQPMNLMQPPSLPVPMNQNPGLPQQFGFPSYPTTESGSSQQF
FT                   FNGAQYEMTRTESGGSEQSSLLGYPPPSPMTNLNFQGSYPPPSWNPGMAPPHTTQQVNR
FT                   GRDGQSFGWPQENRDGFGQE"
     MLQIRLRRDS PTETGNGARP SPTETVTVAC PDHLVLADLP VAKGIGSVTP TTVIKPVGRR        60
     SRRQLGERVH FCVRCDFPIA IYGRLIPCDH AFCLECARSD SICYLCDERI QKIQTIKMME       120
     GIFICAAPHC LRSFLKKLDF EAHVHDLHGS LLQADAEKED GNQSDVQSTM QQSSASESTL       180
     RAPLRSQLQQ SRELNRSASF AKSQSGFSQV QNYPPDSDNS RPPGFETASP KPGIRFPDYP       240
     QPMNLMQPPS LPVPMNQNPG LPQQFGFPSY PTTESGSSQQ FFNGAQYEMT RTESGGSEQS       300
     SLLGYPPPSP MTNLNFQGSY PPPSWNPGMA PPHTTQQVNR GRDGQSFGWP QENRDGFGQE       360
//

If you have problems or comments...

PBIL Back to PBIL home page