(data stored in ACNUC13479 zone)

EMBL: CP002688.PE3

CP002688.PE3         Location/Qualifiers
FT   CDS             complement(join(1388..1459,1572..1646,1745..1780,
FT                   1914..2007,2105..2181,2435..2509,2748..2799,2872..2934,
FT                   3303..3383,3543..3659,3762..3802,3927..4005,4102..4258,
FT                   4335..4467,4552..4679,4765..4924))
FT                   /codon_start=1
FT                   /gene_synonym="TOPTELOMERE.1"
FT                   /gene_synonym="TOPTELOMERE_1"
FT                   /locus_tag="AT5G01010"
FT                   /product="retinal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01010"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7W6"
FT                   /protein_id="ANM68742.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTVMTYMPQDFRGTLIRQQKERSER
FT                   NKQAEVDALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLL
FT                   DFIRQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLS
FT                   EAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISL
FT                   MVESENSYIAWDFSLMQGKISMLPYIRFLLLYLLLFLPDSGYLCFHTYFCCLSSVYISV
FT                   VFYQDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTL
FT                   RYKVDCIAPVVEPDPEPEPLN"
     MASTEGLMPI TRAFLASYYD KYPFSPLSDD VSRLSSDMAS LIKLLTVQSP PSQGETSLID        60
     EANRQPPHKI DENMWKNREQ MEEILFLLSP SRWPVQLREP STSEDAEFAS ILRTLKDSFD       120
     NAFTAMISFQ TKNSERIFST VMTYMPQDFR GTLIRQQKER SERNKQAEVD ALVSSGGSIR       180
     DTYALLWKQQ MERRRQLAQL GSATGVYKTL VKYLVGVPQV LLDFIRQIND DDGPMEEQRE       240
     RYGPPLYSLT KMVIAIRVFL TLLWERYDTF KLSKDQMNLL SEAAIVYTSE FERFVTFISD       300
     VFANSPFFIS ADTAGILWSR DNEEYKEIIV QAGRTYEISL MVESENSYIA WDFSLMQGKI       360
     SMLPYIRFLL LYLLLFLPDS GYLCFHTYFC CLSSVYISVV FYQDIGFSVE YINASGEKTL       420
     ILPYRRYEAD QGNFSTLMAG NYKLVWDNSY STFFKKTLRY KVDCIAPVVE PDPEPEPLN        479
//

If you have problems or comments...

PBIL Back to PBIL home page