(data stored in ACNUC13479 zone)

EMBL: CP002688.PE30

CP002688.PE30        Location/Qualifiers
FT   CDS             join(54280..54534,54657..54715,54959..55727)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.140"
FT                   /gene_synonym="F7J8_140"
FT                   /locus_tag="AT5G01160"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; INVOLVED IN: biological_process unknown;
FT                   LOCATED IN: intracellular; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Zinc finger, C2H2-like
FT                   (InterPro:IPR015880), Zinc finger, RING-type, conserved
FT                   site (InterPro:IPR017907), Zinc finger, RING-type
FT                   (InterPro:IPR001841), Zinc finger, C2H2-type
FT                   (InterPro:IPR007087); Has 1807 Blast hits to 1807 proteins
FT                   in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736;
FT                   Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes -
FT                   339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFC0"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR040380"
FT                   /db_xref="InterPro:IPR040383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP805131.1,INSD:BP616482.1,INSD:ES178989.1,
FT                   INSD:ES147662.1,INSD:DR379092.1,INSD:AI997976.1,
FT                   INSD:DR282566.1,INSD:BP627307.1,INSD:EH941360.1,
FT                   INSD:AV803039.1,INSD:ES146960.1,INSD:EL282499.1,
FT                   INSD:DR282564.1,INSD:BP626024.1,INSD:EL988141.1,
FT                   INSD:BP630593.1,INSD:EL978033.1,INSD:AV557121.1,
FT                   INSD:AV818919.1,INSD:ES131828.1,INSD:DR282561.1,
FT                   INSD:CB074347.1,INSD:DR282562.1,INSD:BP806571.1,
FT                   INSD:AV543449.1,INSD:EL167348.1,INSD:EL240692.1,
FT                   INSD:BP636377.1,INSD:EH966507.1,INSD:BP625721.1,
FT                   INSD:ES155236.1,INSD:BP604314.1,INSD:DR282567.1,
FT                   INSD:BP627814.1,INSD:N37320.1,INSD:AV439570.1,
FT                   INSD:EH919038.1,INSD:AV556858.1,INSD:EL997994.1,
FT                   INSD:DR282565.1,INSD:DR282563.1,INSD:EH811312.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX830977.1,INSD:AY084366.1,INSD:AK227241.1,
FT                   INSD:BT024744.1,INSD:BX829595.1,INSD:BX830386.1,
FT                   INSD:BX831145.1,INSD:BX831309.1,INSD:BX833520.1,
FT                   INSD:BX831546.1"
FT                   /protein_id="AED90305.1"
FT                   /translation="MLQIRLRRDSPTETGNGARPSPTETVTVACPDHLVLADLPVAKGI
FT                   GSVTPTTVIKPVGRRSRRQLGERVHFCVRCDFPIAIYGRLIPCDHAFCLECARSDSICY
FT                   LCDERIQKIQTIKMMEGIFICAAPHCLRSFLKKLDFEAHVHDLHGSLLQADAEKEDGNQ
FT                   SDVQSTMQQSSASESTLRAPLRSQLQQSRELNRSASFAKSQSGFSQVQNYPPDSDNSRP
FT                   PGFETASPKPGIRFPDYPQPMNLMQPPSLPVPMNQNPGLPQQFGFPSYPTTESGSSQQF
FT                   FNGAQYEMTRTESGGSEQSSLLGYPPPSPMTNLNFQGSYPPPSWNPGMAPPHTTQQVNR
FT                   GRDGQSFGWPQENRDGFGQE"
     MLQIRLRRDS PTETGNGARP SPTETVTVAC PDHLVLADLP VAKGIGSVTP TTVIKPVGRR        60
     SRRQLGERVH FCVRCDFPIA IYGRLIPCDH AFCLECARSD SICYLCDERI QKIQTIKMME       120
     GIFICAAPHC LRSFLKKLDF EAHVHDLHGS LLQADAEKED GNQSDVQSTM QQSSASESTL       180
     RAPLRSQLQQ SRELNRSASF AKSQSGFSQV QNYPPDSDNS RPPGFETASP KPGIRFPDYP       240
     QPMNLMQPPS LPVPMNQNPG LPQQFGFPSY PTTESGSSQQ FFNGAQYEMT RTESGGSEQS       300
     SLLGYPPPSP MTNLNFQGSY PPPSWNPGMA PPHTTQQVNR GRDGQSFGWP QENRDGFGQE       360
//

If you have problems or comments...

PBIL Back to PBIL home page