(data stored in ACNUC13479 zone)

EMBL: CP002688.PE31

CP002688.PE31        Location/Qualifiers
FT   CDS             58315..60021
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.150"
FT                   /gene_synonym="F7J8_150"
FT                   /locus_tag="AT5G01170"
FT                   /product="hypothetical protein (DUF740)"
FT                   /note="Protein of unknown function (DUF740); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF740
FT                   (InterPro:IPR008004); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF740)
FT                   (TAIR:AT3G09070.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01170"
FT                   /db_xref="GOA:Q9LFB9"
FT                   /db_xref="InterPro:IPR008004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFB9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR236106.1,INSD:ES163573.1,INSD:AU227549.1,
FT                   INSD:DR369859.1,INSD:DR199830.1,INSD:AU236596.1,
FT                   INSD:DR383575.1,INSD:DR369948.1,INSD:DR350065.1,
FT                   INSD:DR383601.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT004217.1,INSD:BT015922.1"
FT                   /protein_id="AED90306.1"
FT                   /translation="MNLSADQAPVTAVDELAPPSQPHRLSTSCDLHPEERFSGFCPSCL
FT                   CDRLSVLDHNAAPPPSSSSRKPPSISAVSLKALFKPSSSGTNNSNGNGRVRPGFFPELR
FT                   RTKSFSAKNNEGFSGGFEPQRRSCDVRLRDDERNLPINEAASVDKIEEEARESSVSEIV
FT                   LEVTEEAEIEEDEENGEKDPGEIVEEKSSEIGEEEEELKPMKDYMDLYSQTKKPSVKDF
FT                   AGSFFSAASVFSKKLQKWKQKQKVKKPRNGVGGGRPQSEIGVGRRSSDTDPRFSLDAGR
FT                   FSVDIGRISMDDSRYSLDEPRASWDGHLIGRTTAARVPLPPSMLSVVENAPLNRSDMQI
FT                   PSSPSIKPISGDSDPIIIIPGGSNQTRDYYTGPPSSRRRKSLDRSNSIRKIVTELEDVK
FT                   SVSNSTTTIDSNSMETAENKGNQNGDKKSRRWGKWSILGFIYRKGKDDEEEDRYSRSNS
FT                   AGMVERSLSESWPEMRNGEGGGPKMRRSNSNVSWRSSGGGSARNKSSRYSSKDGENGML
FT                   RFYLTPMRRSWKTSGGSGGGGGGGGGGGWEKTAAKANSHGHSIARRVMRLY"
     MNLSADQAPV TAVDELAPPS QPHRLSTSCD LHPEERFSGF CPSCLCDRLS VLDHNAAPPP        60
     SSSSRKPPSI SAVSLKALFK PSSSGTNNSN GNGRVRPGFF PELRRTKSFS AKNNEGFSGG       120
     FEPQRRSCDV RLRDDERNLP INEAASVDKI EEEARESSVS EIVLEVTEEA EIEEDEENGE       180
     KDPGEIVEEK SSEIGEEEEE LKPMKDYMDL YSQTKKPSVK DFAGSFFSAA SVFSKKLQKW       240
     KQKQKVKKPR NGVGGGRPQS EIGVGRRSSD TDPRFSLDAG RFSVDIGRIS MDDSRYSLDE       300
     PRASWDGHLI GRTTAARVPL PPSMLSVVEN APLNRSDMQI PSSPSIKPIS GDSDPIIIIP       360
     GGSNQTRDYY TGPPSSRRRK SLDRSNSIRK IVTELEDVKS VSNSTTTIDS NSMETAENKG       420
     NQNGDKKSRR WGKWSILGFI YRKGKDDEEE DRYSRSNSAG MVERSLSESW PEMRNGEGGG       480
     PKMRRSNSNV SWRSSGGGSA RNKSSRYSSK DGENGMLRFY LTPMRRSWKT SGGSGGGGGG       540
     GGGGGWEKTA AKANSHGHSI ARRVMRLY                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page