(data stored in ACNUC13479 zone)

EMBL: CP002688.PE37

CP002688.PE37        Location/Qualifiers
FT   CDS             join(77116..77576,77952..78294)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.180"
FT                   /gene_synonym="F7J8_180"
FT                   /locus_tag="AT5G01200"
FT                   /product="Duplicated homeodomain-like superfamily protein"
FT                   /note="Duplicated homeodomain-like superfamily protein;
FT                   CONTAINS InterPro DOMAIN/s: Molecular chaperone, heat shock
FT                   protein, Hsp40, DnaJ (InterPro:IPR015609), SANT, eukarya
FT                   (InterPro:IPR017884), Myb-like DNA-binding domain, SHAQKYF
FT                   class (InterPro:IPR006447), SANT, DNA-binding
FT                   (InterPro:IPR001005), Myb, DNA-binding
FT                   (InterPro:IPR014778), Homeodomain-like
FT                   (InterPro:IPR009057), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930); BEST
FT                   Arabidopsis thaliana protein match is: Duplicated
FT                   homeodomain-like superfamily protein (TAIR:AT2G38090.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01200"
FT                   /db_xref="GOA:Q9LFB6"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV562130.1,INSD:ES169273.1,INSD:AV559299.1,
FT                   INSD:DR749785.1,INSD:DR749786.1,INSD:ES056308.1,
FT                   INSD:AV441418.1,INSD:EL991022.1,INSD:AA597360.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY519530.1"
FT                   /protein_id="AED90309.1"
FT                   /translation="MSSSTMYRGVNMFSPANTNWIFQEVREATWTAEENKRFEKALAYL
FT                   DDKDNLESWSKIADLIPGKTVADVIKRYKELEDDVSDIEAGLIPIPGYGGDASSAANSD
FT                   YFFGLENSSYGYDYVVGGKRSSPAMTDCFRSPMPEKERKKGVPWTEDEHLRFLMGLKKY
FT                   GKGDWRNIAKSFVTTRTPTQVASHAQKYFLRQLTDGKDKRRSSIHDITTVNIPDADASA
FT                   TATTADVALSPTPANSFDVFLQPNPHYSFASASASSYYNAFPQWS"
     MSSSTMYRGV NMFSPANTNW IFQEVREATW TAEENKRFEK ALAYLDDKDN LESWSKIADL        60
     IPGKTVADVI KRYKELEDDV SDIEAGLIPI PGYGGDASSA ANSDYFFGLE NSSYGYDYVV       120
     GGKRSSPAMT DCFRSPMPEK ERKKGVPWTE DEHLRFLMGL KKYGKGDWRN IAKSFVTTRT       180
     PTQVASHAQK YFLRQLTDGK DKRRSSIHDI TTVNIPDADA SATATTADVA LSPTPANSFD       240
     VFLQPNPHYS FASASASSYY NAFPQWS                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page