(data stored in ACNUC13479 zone)

EMBL: CP002688.PE38

CP002688.PE38        Location/Qualifiers
FT   CDS             84554..85981
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.190"
FT                   /gene_synonym="F7J8_190"
FT                   /locus_tag="AT5G01210"
FT                   /product="HXXXD-type acyl-transferase family protein"
FT                   /note="HXXXD-type acyl-transferase family protein;
FT                   FUNCTIONS IN: transferase activity, transferring acyl
FT                   groups other than amino-acyl groups, transferase activity;
FT                   INVOLVED IN: biological_process unknown; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Transferase (InterPro:IPR003480); BEST
FT                   Arabidopsis thaliana protein match is: HXXXD-type
FT                   acyl-transferase family protein (TAIR:AT2G39980.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01210"
FT                   /db_xref="GOA:Q9LFB5"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV802611.1,INSD:EH861324.1,INSD:BP846622.1,
FT                   INSD:EL142230.1,INSD:BP810310.1,INSD:EL286263.1,
FT                   INSD:EL180315.1,INSD:EL026361.1,INSD:EG446944.1,
FT                   INSD:BP616221.1,INSD:EL203761.1,INSD:EL289267.1,
FT                   INSD:AV549757.1,INSD:BP597645.1,INSD:BE038811.1,
FT                   INSD:EH851838.1,INSD:EL029540.1,INSD:EH843524.1,
FT                   INSD:EG520327.1,INSD:EH880521.1,INSD:DR277441.1,
FT                   INSD:ES083467.1,INSD:EL120956.1,INSD:EL044455.1,
FT                   INSD:EL061977.1,INSD:AV815496.1,INSD:BP576300.1,
FT                   INSD:EH940334.1,INSD:EL038872.1,INSD:BP585479.1,
FT                   INSD:AV441577.1,INSD:AU231413.1,INSD:BP810930.1,
FT                   INSD:EL119588.1,INSD:EH845182.1,INSD:EH931147.1,
FT                   INSD:EG496360.1,INSD:EL023629.1,INSD:AV831217.1,
FT                   INSD:DR277439.1,INSD:EH973394.1,INSD:CB257290.1,
FT                   INSD:CF651460.1,INSD:CB185631.1,INSD:AV439866.1,
FT                   INSD:EL161364.1,INSD:AV525248.1,INSD:BP617184.1,
FT                   INSD:EL000466.1,INSD:CF651461.1,INSD:BP810889.1,
FT                   INSD:AI992711.1,INSD:EL251207.1,INSD:R64951.1,
FT                   INSD:EL275218.1,INSD:EL108295.1,INSD:DR277440.1,
FT                   INSD:EL010267.1,INSD:AV534126.1,INSD:EL216601.1,
FT                   INSD:EH798532.1,INSD:EH873268.1,INSD:Z34199.1,
FT                   INSD:EL057253.1,INSD:EL044255.1,INSD:EG520326.1,
FT                   INSD:AV814945.1,INSD:ES016673.1,INSD:EH959985.1,
FT                   INSD:EL203084.1,INSD:BP620245.1,INSD:EH864522.1,
FT                   INSD:AV518442.1,INSD:EL328936.1,INSD:AV539490.1,
FT                   INSD:EL230105.1,INSD:EL285901.1,INSD:EH830017.1,
FT                   INSD:EL288604.1,INSD:AV525044.1,INSD:BP853597.1,
FT                   INSD:AV548595.1,INSD:BP616519.1,INSD:EL056563.1,
FT                   INSD:EL341663.1,INSD:AV518287.1,INSD:EL125351.1,
FT                   INSD:EH873745.1,INSD:ES126423.1,INSD:DR277444.1,
FT                   INSD:N95993.1,INSD:BP572016.1,INSD:EL078817.1,
FT                   INSD:EL228634.1,INSD:EH945221.1,INSD:ES123246.1,
FT                   INSD:EH835220.1,INSD:EH836812.1,INSD:BP807445.1,
FT                   INSD:EL313180.1,INSD:EL260835.1,INSD:BP621142.1,
FT                   INSD:BP586074.1,INSD:AV828731.1,INSD:EH982768.1,
FT                   INSD:BP671901.1,INSD:EL335605.1,INSD:BP822633.1,
FT                   INSD:BP569061.1,INSD:EH970548.1,INSD:DR277445.1,
FT                   INSD:EL233748.1,INSD:T41686.1,INSD:EH833701.1,
FT                   INSD:DR277443.1,INSD:DR277442.1,INSD:EL044308.1,
FT                   INSD:EL004625.1,INSD:BP602937.1,INSD:EL094217.1,
FT                   INSD:AV803113.1,INSD:ES061240.1,INSD:W43665.1,
FT                   INSD:Z34616.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX830368.1,INSD:AY090321.1,INSD:BX832518.1,
FT                   INSD:AK227159.1,INSD:AY056412.1,INSD:BX830266.1"
FT                   /protein_id="AED90310.1"
FT                   /translation="MPSCSVTEISKCIVYPEKKSTVSDLRLSVSDLPMLSCHYIQKGVL
FT                   LTSPPPSFSFDDLVSSLRRSLSSTLSLFPALAGRFSTTPAGHISIVCNDAGVDFVAASA
FT                   KHVKLSDVLLPGEDVPLLFREFFVFERLVSYNGHHKPLAAVQVTELHDGVFIGCTVNHS
FT                   VTDGTSFWHFFNTFADVTSGACKIKHLPDFSRHTVFDSPVVLPVPPGGPRVTFDADQPL
FT                   RERIFHFSREAITKLKQRTNNRVNGIETAVNDGRKCNGEINGKITTVLDSFLNNKKSYD
FT                   RTAEISSFQSLSAQLWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSI
FT                   PTLASAGDLLSKDLRWSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITM
FT                   GSSPRFPMYDNDFGWGKPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMTGI
FT                   ENDAEFMQYVSEVTYDC"
     MPSCSVTEIS KCIVYPEKKS TVSDLRLSVS DLPMLSCHYI QKGVLLTSPP PSFSFDDLVS        60
     SLRRSLSSTL SLFPALAGRF STTPAGHISI VCNDAGVDFV AASAKHVKLS DVLLPGEDVP       120
     LLFREFFVFE RLVSYNGHHK PLAAVQVTEL HDGVFIGCTV NHSVTDGTSF WHFFNTFADV       180
     TSGACKIKHL PDFSRHTVFD SPVVLPVPPG GPRVTFDADQ PLRERIFHFS REAITKLKQR       240
     TNNRVNGIET AVNDGRKCNG EINGKITTVL DSFLNNKKSY DRTAEISSFQ SLSAQLWRSV       300
     TRARNLDPSK TTTFRMAVNC RHRLEPKMDP YYFGNAIQSI PTLASAGDLL SKDLRWSAEQ       360
     LHRNVVAHDD ATVRRGIAAW ESDPRLFPLG NPDGASITMG SSPRFPMYDN DFGWGKPLAV       420
     RSGGANKFDG KISAFPGREG NGSVDLEVVL APETMTGIEN DAEFMQYVSE VTYDC            475
//

If you have problems or comments...

PBIL Back to PBIL home page