(data stored in ACNUC13479 zone)

EMBL: CP002688.PE41

CP002688.PE41        Location/Qualifiers
FT   CDS             91920..92324
FT                   /codon_start=1
FT                   /locus_tag="AT5G01225"
FT                   /product="josephin-like protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT3G09032.1); Has 30201
FT                   Blast hits to 17322 proteins in 780 species: Archae - 12;
FT                   Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
FT                   5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01225"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01225.1"
FT                   /db_xref="GOA:Q3E9N0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3E9N0"
FT                   /protein_id="AED90312.1"
FT                   /translation="MSRRASKRVRFSPDPEANDELIFPTHSSSRHGRRRVVVGIFSFSF
FT                   SDSPATTKRLLRSIGDRVGKTFRYISFGRMNTKTTPSSSSNVSSSLYLMKSKSLNGSES
FT                   HRAEAIEDCIEFLNSCSSLSRSNSISTWSR"
     MSRRASKRVR FSPDPEANDE LIFPTHSSSR HGRRRVVVGI FSFSFSDSPA TTKRLLRSIG        60
     DRVGKTFRYI SFGRMNTKTT PSSSSNVSSS LYLMKSKSLN GSESHRAEAI EDCIEFLNSC       120
     SSLSRSNSIS TWSR                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page