(data stored in ACNUC13479 zone)

EMBL: CP002688.PE42

CP002688.PE42        Location/Qualifiers
FT   CDS             complement(join(92789..93009,93289..93396,93521..93584,
FT                   93734..93826,93949..94001,94086..94146,94264..94372,
FT                   94482..94531,94948..94997,95155..95248,95354..95380))
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.210"
FT                   /gene_synonym="F7J8_210"
FT                   /locus_tag="AT5G01230"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; FUNCTIONS IN: methyltransferase
FT                   activity, nucleic acid binding; INVOLVED IN: methylation,
FT                   rRNA methylation; LOCATED IN: cellular_component unknown;
FT                   EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Ribosomal RNA
FT                   methyltransferase J (InterPro:IPR015507), Ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ (InterPro:IPR002877); BEST
FT                   Arabidopsis thaliana protein match is: FtsJ-like
FT                   methyltransferase family protein (TAIR:AT4G25730.1); Has
FT                   5711 Blast hits to 5669 proteins in 1418 species: Archae -
FT                   154; Bacteria - 2315; Metazoa - 596; Fungi - 413; Plants -
FT                   124; Viruses - 65; Other Eukaryotes - 2044 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01230"
FT                   /db_xref="GOA:Q8GUN8"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR028590"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GUN8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR376531.1,INSD:DR340118.1,INSD:ES195894.1,
FT                   INSD:DR340117.1,INSD:AV782172.1,INSD:ES006860.1,
FT                   INSD:ES112689.1,INSD:ES077788.1,INSD:BP864121.1,
FT                   INSD:ES093155.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT002330.1"
FT                   /protein_id="AED90314.1"
FT                   /translation="MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRV
FT                   VDLCAAPGSWSQVLSRQLYLPAKSSAESKDGDLPLIVAIDLQPMAPIEGVIQVQGDITN
FT                   ARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTIVTHILKEGGKF
FT                   IAKIFRGKDTSLLYCQLKLFFPTVTFAKPKSSRNSSIEAFAVCENYSPPEGFNPRDLHR
FT                   LLEKVGSPSGGSDLDCSSGWLEGPNKVYIPFLACGDLTGYDSDRSYPLPREADGSSYQS
FT                   LDPIQPPIAPPYKRALELKKASAQSFNS"
     MGKASRDKRD IYYRKAKEEG WRARSAFKLL QIDEEFNIFE GVKRVVDLCA APGSWSQVLS        60
     RQLYLPAKSS AESKDGDLPL IVAIDLQPMA PIEGVIQVQG DITNARTAEV VIRHFDGCKA       120
     DLVVCDGAPD VTGLHDMDEF VQSQLILAGL TIVTHILKEG GKFIAKIFRG KDTSLLYCQL       180
     KLFFPTVTFA KPKSSRNSSI EAFAVCENYS PPEGFNPRDL HRLLEKVGSP SGGSDLDCSS       240
     GWLEGPNKVY IPFLACGDLT GYDSDRSYPL PREADGSSYQ SLDPIQPPIA PPYKRALELK       300
     KASAQSFNS                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page