(data stored in ACNUC13479 zone)

EMBL: CP002688.PE43

CP002688.PE43        Location/Qualifiers
FT   CDS             complement(join(94694..94708,94948..94997,95155..95248,
FT                   95354..95380))
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.210"
FT                   /gene_synonym="F7J8_210"
FT                   /locus_tag="AT5G01230"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; FUNCTIONS IN: methyltransferase
FT                   activity, nucleic acid binding; INVOLVED IN: methylation,
FT                   rRNA methylation; LOCATED IN: cellular_component unknown;
FT                   EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Ribosomal RNA
FT                   methyltransferase J (InterPro:IPR015507), Ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ (InterPro:IPR002877); BEST
FT                   Arabidopsis thaliana protein match is: FtsJ-like
FT                   methyltransferase family protein (TAIR:AT4G25730.1); Has
FT                   30201 Blast hits to 17322 proteins in 780 species: Archae -
FT                   12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants
FT                   - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01230"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01230.2"
FT                   /db_xref="GOA:F4K7Z6"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR028590"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7Z6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES095525.1,INSD:DR376531.1,INSD:ES019084.1,
FT                   INSD:ES195894.1,INSD:DR340117.1,INSD:AV782172.1,
FT                   INSD:ES006860.1,INSD:ES112689.1,INSD:AV821653.1,
FT                   INSD:ES011037.1,INSD:ES093155.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY050853.1"
FT                   /protein_id="AED90313.1"
FT                   /translation="MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRV
FT                   VDLCAAPGSWSQSGRS"
     MGKASRDKRD IYYRKAKEEG WRARSAFKLL QIDEEFNIFE GVKRVVDLCA APGSWSQSGR        60
     S                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page