(data stored in ACNUC13479 zone)

EMBL: CP002688.PE45

CP002688.PE45        Location/Qualifiers
FT   CDS             join(98663..98803,98931..99043,99176..99359,99441..99538,
FT                   100118..100325,100634..100891,101269..101493)
FT                   /codon_start=1
FT                   /gene="LAX1"
FT                   /gene_synonym="F7J8.220"
FT                   /gene_synonym="F7J8_220"
FT                   /gene_synonym="like AUXIN RESISTANT 1"
FT                   /locus_tag="AT5G01240"
FT                   /product="like AUXIN RESISTANT 1"
FT                   /note="like AUXIN RESISTANT 1 (LAX1); FUNCTIONS IN:
FT                   transporter activity; INVOLVED IN: amino acid transport,
FT                   root cap development; LOCATED IN: endomembrane system,
FT                   membrane; EXPRESSED IN: 20 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Amino
FT                   acid transporter, transmembrane (InterPro:IPR013057); BEST
FT                   Arabidopsis thaliana protein match is: Transmembrane amino
FT                   acid transporter family protein (TAIR:AT2G38120.1); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01240"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01240.2"
FT                   /db_xref="GOA:F4K7Z8"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7Z8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP787325.1,INSD:AV786500.1,INSD:BP780173.1,
FT                   INSD:EH860636.1,INSD:EH878879.1,INSD:EL083575.1,
FT                   INSD:BP664740.1,INSD:BP591839.1,INSD:BP654245.1,
FT                   INSD:BP664825.1,INSD:EH972697.1,INSD:BP647266.1,
FT                   INSD:AV790258.1,INSD:EL063314.1,INSD:EL022068.1,
FT                   INSD:EL240342.1,INSD:EL283994.1,INSD:EH835424.1,
FT                   INSD:CF773448.1,INSD:EH846141.1,INSD:EL072648.1,
FT                   INSD:BP779699.1,INSD:EL163876.1,INSD:EL215878.1,
FT                   INSD:EL170376.1,INSD:BP615918.1,INSD:EH984785.1,
FT                   INSD:EL187318.1,INSD:BP644678.1,INSD:BP587397.1,
FT                   INSD:BP665586.1,INSD:EL165075.1,INSD:EH804336.1,
FT                   INSD:BP638154.1,INSD:EL155882.1,INSD:EL014164.1,
FT                   INSD:BP659331.1,INSD:EH984893.1,INSD:BP792310.1,
FT                   INSD:DR363559.1,INSD:AV781921.1,INSD:EG493607.1,
FT                   INSD:EL106371.1,INSD:EH938681.1,INSD:EL150053.1,
FT                   INSD:EL134083.1,INSD:EL078195.1,INSD:EH922564.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX830786.1,INSD:BX830611.1"
FT                   /protein_id="AED90316.1"
FT                   /translation="MLSGILLQIFYGLMGSWTAYLISVLYVEYRARMEKQEAKSFKNHV
FT                   IQWFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIACASNIYYINDRLDKRTWTYIFG
FT                   ACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLTIASFLHGQAEGVTHSGPTKLVLYFT
FT                   GATNILYTFGGHAVTVEIMHAMWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLL
FT                   NHSNAFSLLPKTRFRDTAVILMLIHQFITFGFACTPLYFVWEKAIGMHHTKSLCLRALV
FT                   RLPVVVPIWFLAIIFPFFGPINSAVGALLVTFTVYIIPALAHMLTYRTASARRNAAEKP
FT                   PFFIPSWAGVYVINAFIVVWVLVLGFGFGGWASMTNFIRQIDTFGLFAKCYQCKPPPAP
FT                   IAAGAHHRR"
     MLSGILLQIF YGLMGSWTAY LISVLYVEYR ARMEKQEAKS FKNHVIQWFE VLDGLLGPYW        60
     KAAGLAFNCT FLLFGSVIQL IACASNIYYI NDRLDKRTWT YIFGACCATT VFIPSFHNYR       120
     IWSFLGLGMT TYTAWYLTIA SFLHGQAEGV THSGPTKLVL YFTGATNILY TFGGHAVTVE       180
     IMHAMWKPRK FKSIYLMATL YVFTLTLPSA SAVYWAFGDQ LLNHSNAFSL LPKTRFRDTA       240
     VILMLIHQFI TFGFACTPLY FVWEKAIGMH HTKSLCLRAL VRLPVVVPIW FLAIIFPFFG       300
     PINSAVGALL VTFTVYIIPA LAHMLTYRTA SARRNAAEKP PFFIPSWAGV YVINAFIVVW       360
     VLVLGFGFGG WASMTNFIRQ IDTFGLFAKC YQCKPPPAPI AAGAHHRR                    408
//

If you have problems or comments...

PBIL Back to PBIL home page