(data stored in ACNUC13479 zone)

EMBL: CP002688.PE46

CP002688.PE46        Location/Qualifiers
FT   CDS             complement(102370..103593)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.230"
FT                   /gene_synonym="F7J8_230"
FT                   /locus_tag="AT5G01250"
FT                   /product="alpha 1,4-glycosyltransferase family protein"
FT                   /note="alpha 1,4-glycosyltransferase family protein;
FT                   FUNCTIONS IN: transferase activity, transferring glycosyl
FT                   groups, transferase activity; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: Golgi stack;
FT                   CONTAINS InterPro DOMAIN/s: Alpha 1,4-glycosyltransferase
FT                   conserved region (InterPro:IPR007652), Glycosyltransferase,
FT                   DXD sugar-binding region (InterPro:IPR007577); BEST
FT                   Arabidopsis thaliana protein match is: alpha
FT                   1,4-glycosyltransferase family protein (TAIR:AT3G09020.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01250"
FT                   /db_xref="GOA:Q9LFB1"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR007652"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA721858.1,INSD:AU237937.1,INSD:AU229051.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832384.1,INSD:BT015324.1,INSD:BX832585.1,
FT                   INSD:AK229418.1"
FT                   /protein_id="AED90317.1"
FT                   /translation="MDRHDIEKRFTVVIDNRRLNQSGSSSLFTAFAISFVTLIVVTTFT
FT                   LISNFSMQPHRDFSGVKIEIKRVIPHLPLSSEREGERSDLLKQQTQVNEKLQVIEVFSG
FT                   DNLSDKFQKRVNEFVGDGCEVNFVMTWISPADFFGNREVLAIESVFKSHPYGCLMILSA
FT                   TMDSPQGYATLKPFIDRGYKVLAVTPDLPFLLKGTAGELWLDEIKSGKRDPGKISLAQN
FT                   LSNLMRLAYLYKYGGVYLDTDMIVLKSFKGLRNVIGAQTLDPSSTNWTRLNNAVLIFDK
FT                   NHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVARAVEGSSGYNFTVMRPSVFYSVNWLE
FT                   IKKLFKVPKTEKDSKWVKTKLLHMQRNGYGLHLWNKFSRKYEIEQGSAMWKLVSEHCII
FT                   CEISSVSS"
     MDRHDIEKRF TVVIDNRRLN QSGSSSLFTA FAISFVTLIV VTTFTLISNF SMQPHRDFSG        60
     VKIEIKRVIP HLPLSSEREG ERSDLLKQQT QVNEKLQVIE VFSGDNLSDK FQKRVNEFVG       120
     DGCEVNFVMT WISPADFFGN REVLAIESVF KSHPYGCLMI LSATMDSPQG YATLKPFIDR       180
     GYKVLAVTPD LPFLLKGTAG ELWLDEIKSG KRDPGKISLA QNLSNLMRLA YLYKYGGVYL       240
     DTDMIVLKSF KGLRNVIGAQ TLDPSSTNWT RLNNAVLIFD KNHPLLLKFM EEFAKTFNGN       300
     IWGYNGPYLV SRVARAVEGS SGYNFTVMRP SVFYSVNWLE IKKLFKVPKT EKDSKWVKTK       360
     LLHMQRNGYG LHLWNKFSRK YEIEQGSAMW KLVSEHCIIC EISSVSS                     407
//

If you have problems or comments...

PBIL Back to PBIL home page