(data stored in ACNUC13479 zone)

EMBL: CP002688.PE47

CP002688.PE47        Location/Qualifiers
FT   CDS             join(105367..105582,105697..105888,105976..106476,
FT                   106797..107045)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.240"
FT                   /gene_synonym="F7J8_240"
FT                   /locus_tag="AT5G01260"
FT                   /product="Carbohydrate-binding-like fold"
FT                   /note="Carbohydrate-binding-like fold; FUNCTIONS IN:
FT                   carbohydrate binding, catalytic activity; INVOLVED IN:
FT                   carbohydrate metabolic process; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 21 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Immunoglobulin-like fold
FT                   (InterPro:IPR013783), Carbohydrate-binding-like fold
FT                   (InterPro:IPR013784), Glycoside hydrolase,
FT                   carbohydrate-binding (InterPro:IPR002044); BEST Arabidopsis
FT                   thaliana protein match is: catalytics;carbohydrate
FT                   kinases;phosphoglucan, water dikinases (TAIR:AT5G26570.1);
FT                   Has 35333 Blast hits to 34131 proteins in 2444 species:
FT                   Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991;
FT                   Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01260"
FT                   /db_xref="GOA:Q9LFB0"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL320757.1,INSD:EH991409.1,INSD:ES157460.1,
FT                   INSD:AV829512.1,INSD:AV806583.1,INSD:EH990665.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX830930.1"
FT                   /protein_id="AED90318.1"
FT                   /translation="MIGIGRTLTSSSPSKIILEDLPPGIYRYGTEIFTSVPRKTFHHIK
FT                   FLRLDSAQSSRILKPVPLRSSSIKDSQVNVEDEEIEASNKTVRVRFQLRKECVFGEHFF
FT                   IVGDDPVFGGLWDPETALPLNWSDGNVWTVDLDLPVGRLVEFKLLLKAQTGEILWQPGP
FT                   NRALETWETNKTIRICEDWDNADLQMMIEEDFVPYTNISSIGSEDEDEVLGSVQQNSSV
FT                   VAVENAGYVSDESAQNSSFSIQSEKTMEPSNGALTAREVIKEAMFTEEESPVLVPGLIP
FT                   LSDLDNEQVEVINEGKAETFPEVDKKQEPKAERNKKAKVKAISLFEKSEQEAVKSVEQR
FT                   QYNAVEEEQQRLETEPLGTPDVLFENDIQWGRRTLYKLLSNFRLF"
     MIGIGRTLTS SSPSKIILED LPPGIYRYGT EIFTSVPRKT FHHIKFLRLD SAQSSRILKP        60
     VPLRSSSIKD SQVNVEDEEI EASNKTVRVR FQLRKECVFG EHFFIVGDDP VFGGLWDPET       120
     ALPLNWSDGN VWTVDLDLPV GRLVEFKLLL KAQTGEILWQ PGPNRALETW ETNKTIRICE       180
     DWDNADLQMM IEEDFVPYTN ISSIGSEDED EVLGSVQQNS SVVAVENAGY VSDESAQNSS       240
     FSIQSEKTME PSNGALTARE VIKEAMFTEE ESPVLVPGLI PLSDLDNEQV EVINEGKAET       300
     FPEVDKKQEP KAERNKKAKV KAISLFEKSE QEAVKSVEQR QYNAVEEEQQ RLETEPLGTP       360
     DVLFENDIQW GRRTLYKLLS NFRLF                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page