(data stored in ACNUC13479 zone)

EMBL: CP002688.PE5

CP002688.PE5         Location/Qualifiers
FT   CDS             complement(join(1527..1646,1745..1780,1914..1961,
FT                   2435..2509,2748..2799,2872..2934,3303..3383,3543..3659,
FT                   3762..3802,3927..4005,4102..4258,4335..4467,4552..4679,
FT                   4765..4924))
FT                   /codon_start=1
FT                   /gene_synonym="TOPTELOMERE.1"
FT                   /gene_synonym="TOPTELOMERE_1"
FT                   /locus_tag="AT5G01010"
FT                   /product="retinal-binding protein"
FT                   /note="EXPRESSED IN: 23 plant structures; EXPRESSED DURING:
FT                   14 growth stages; CONTAINS InterPro DOMAIN/s: GOLD
FT                   (InterPro:IPR009038); Has 76 Blast hits to 76 proteins in
FT                   20 species: Archae - 0; Bacteria - 0; Metazoa - 11; Fungi -
FT                   0; Plants - 62; Viruses - 0; Other Eukaryotes - 3 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01010"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z286"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR187275.1,INSD:DR187260.1,INSD:BP826070.1,
FT                   INSD:ES212707.1,INSD:EH965517.1,INSD:T88327.1,
FT                   INSD:EL220721.1,INSD:EL219028.1,INSD:EH926904.1,
FT                   INSD:DR187266.1,INSD:DR187262.1,INSD:BP814352.2,
FT                   INSD:DR187267.1,INSD:DR187273.1,INSD:BU635629.1,
FT                   INSD:BP815799.1,INSD:BP847683.1,INSD:BP823082.1,
FT                   INSD:BP828812.1,INSD:DR187269.1,INSD:ES181058.1,
FT                   INSD:ES124603.1,INSD:EH956632.1,INSD:BP825768.1,
FT                   INSD:DR187272.1,INSD:BP812360.2,INSD:BP846130.1,
FT                   INSD:EH866827.1,INSD:ES052436.1,INSD:AU239579.1,
FT                   INSD:BP835033.1,INSD:ES206247.1,INSD:EL321475.1,
FT                   INSD:BP812340.1,INSD:BP821517.1,INSD:T21323.1,
FT                   INSD:DR187265.1,INSD:EL123288.1,INSD:BP575092.1,
FT                   INSD:DR187259.1,INSD:ES056933.1,INSD:AV796654.1,
FT                   INSD:BP796965.1,INSD:BP841170.1,INSD:BP800313.1,
FT                   INSD:BP823070.1,INSD:BP827398.1,INSD:EL033065.1,
FT                   INSD:DR187268.1,INSD:DR187271.1,INSD:EL166424.1,
FT                   INSD:BP826832.1,INSD:EL291281.1,INSD:BP567984.1,
FT                   INSD:EL184120.1,INSD:DR187270.1,INSD:EH912904.1,
FT                   INSD:EL093261.1,INSD:BP836409.1,INSD:BP828424.1,
FT                   INSD:BP818936.1,INSD:CF773050.1,INSD:BP815149.1,
FT                   INSD:EL995855.1,INSD:ES113294.1,INSD:ES081715.1,
FT                   INSD:EL088227.1,INSD:AV802222.1,INSD:EL002964.1,
FT                   INSD:BP800752.1,INSD:BP867737.1,INSD:EH937758.1,
FT                   INSD:ES214429.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX841661.1"
FT                   /protein_id="AED90284.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTVMTYMPQDFRGTLIRQQKERSER
FT                   NKQAEVDALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLL
FT                   DFIRQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLS
FT                   EAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISL
FT                   MVESENSYIAWDFSLMQGKISMDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAG
FT                   NYKLVWDNSYSTFFKKVGRYLHFGVDGVNQ"
     MASTEGLMPI TRAFLASYYD KYPFSPLSDD VSRLSSDMAS LIKLLTVQSP PSQGETSLID        60
     EANRQPPHKI DENMWKNREQ MEEILFLLSP SRWPVQLREP STSEDAEFAS ILRTLKDSFD       120
     NAFTAMISFQ TKNSERIFST VMTYMPQDFR GTLIRQQKER SERNKQAEVD ALVSSGGSIR       180
     DTYALLWKQQ MERRRQLAQL GSATGVYKTL VKYLVGVPQV LLDFIRQIND DDGPMEEQRE       240
     RYGPPLYSLT KMVIAIRVFL TLLWERYDTF KLSKDQMNLL SEAAIVYTSE FERFVTFISD       300
     VFANSPFFIS ADTAGILWSR DNEEYKEIIV QAGRTYEISL MVESENSYIA WDFSLMQGKI       360
     SMDIGFSVEY INASGEKTLI LPYRRYEADQ GNFSTLMAGN YKLVWDNSYS TFFKKVGRYL       420
     HFGVDGVNQ                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page