(data stored in ACNUC13479 zone)

EMBL: CP002688.PE52

CP002688.PE52        Location/Qualifiers
FT   CDS             complement(join(114185..114373,114465..115487,
FT                   115604..115691,116155..116266,116344..116386))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.1"
FT                   /gene_synonym="BASIC PROLINE-RICH PROTEIN3"
FT                   /gene_synonym="BPP3"
FT                   /locus_tag="AT5G01280"
FT                   /product="GPI-anchored protein"
FT                   /note="BEST Arabidopsis thaliana protein match is:
FT                   proline-rich family protein (TAIR:AT3G09000.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01280"
FT                   /db_xref="UniProtKB/TrEMBL:F4K804"
FT                   /inference="similar to RNA sequence, EST:INSD:T12964.1"
FT                   /protein_id="AED90322.2"
FT                   /translation="MRRCEKRHRPTLLMESDNTSSTTAMSSQQYPVRRTAGENLLYSDG
FT                   EKSDYEWLVTPPGSPSRNVTNHLNAPDDNLMTLISRLENYSKEESEHQTTSLHSSSSVS
FT                   GIRRPSSSSSSRSTSRPPTPTRKSKTPAKRPSTPTSRATSTTTRATLTSSSTTSSTRSW
FT                   SRPSSSSGTGTSRVTLTAARATRPTTSTDQQTTGSATSTRSNNRPMSAPNSKPGSRSST
FT                   PTRRPSTPNGSSTVLRSKPTKPLSKPALSLEASPIVRSRPWEPYEMPGFSVEAPSNLRT
FT                   TLPDRPQTASSSRTRAFDASSSSRSASTERDVAKRQSCSPSRSRAPNGNVNGAVPSLRG
FT                   QRAKTNNDDGRLISHAAKGNQKVEKVVNMRKLATPRLTESGSRRLGGGGGDSSAGKSSS
FT                   GSGGFGFGRNLSKSSIDMALRHMDVRKGSMAGNFRHSVTKAPATSVYSVRSCRNRPVSS
FT                   SRSSESSVNILCLDGSDDNLSDMSCS"
     MRRCEKRHRP TLLMESDNTS STTAMSSQQY PVRRTAGENL LYSDGEKSDY EWLVTPPGSP        60
     SRNVTNHLNA PDDNLMTLIS RLENYSKEES EHQTTSLHSS SSVSGIRRPS SSSSSRSTSR       120
     PPTPTRKSKT PAKRPSTPTS RATSTTTRAT LTSSSTTSST RSWSRPSSSS GTGTSRVTLT       180
     AARATRPTTS TDQQTTGSAT STRSNNRPMS APNSKPGSRS STPTRRPSTP NGSSTVLRSK       240
     PTKPLSKPAL SLEASPIVRS RPWEPYEMPG FSVEAPSNLR TTLPDRPQTA SSSRTRAFDA       300
     SSSSRSASTE RDVAKRQSCS PSRSRAPNGN VNGAVPSLRG QRAKTNNDDG RLISHAAKGN       360
     QKVEKVVNMR KLATPRLTES GSRRLGGGGG DSSAGKSSSG SGGFGFGRNL SKSSIDMALR       420
     HMDVRKGSMA GNFRHSVTKA PATSVYSVRS CRNRPVSSSR SSESSVNILC LDGSDDNLSD       480
     MSCS                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page