(data stored in ACNUC13479 zone)

EMBL: CP002688.PE54

CP002688.PE54        Location/Qualifiers
FT   CDS             complement(join(114456..115487,115604..115691,
FT                   116155..116237))
FT                   /codon_start=1
FT                   /gene_synonym="BASIC PROLINE-RICH PROTEIN3"
FT                   /gene_synonym="BPP3"
FT                   /gene_synonym="T10O8.1"
FT                   /locus_tag="AT5G01280"
FT                   /product="GPI-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B9S1"
FT                   /protein_id="ANM68342.1"
FT                   /translation="MSSQQYPVRRTAGENLLYSDGEKSDYEWLVTPPGSPSRNVTNHLN
FT                   APDDNLMTLISRLENYSKEESEHQTTSLHSSSSVSGIRRPSSSSSSRSTSRPPTPTRKS
FT                   KTPAKRPSTPTSRATSTTTRATLTSSSTTSSTRSWSRPSSSSGTGTSRVTLTAARATRP
FT                   TTSTDQQTTGSATSTRSNNRPMSAPNSKPGSRSSTPTRRPSTPNGSSTVLRSKPTKPLS
FT                   KPALSLEASPIVRSRPWEPYEMPGFSVEAPSNLRTTLPDRPQTASSSRTRAFDASSSSR
FT                   SASTERDVAKRQSCSPSRSRAPNGNVNGAVPSLRGQRAKTNNDDGRLISHAAKGNQKVE
FT                   KVVNMRKLATPRLTESGSRRLGGGGGDSSAGKSSSGSGGFGFGRNLSKSSIDMALRHMV
FT                   R"
     MSSQQYPVRR TAGENLLYSD GEKSDYEWLV TPPGSPSRNV TNHLNAPDDN LMTLISRLEN        60
     YSKEESEHQT TSLHSSSSVS GIRRPSSSSS SRSTSRPPTP TRKSKTPAKR PSTPTSRATS       120
     TTTRATLTSS STTSSTRSWS RPSSSSGTGT SRVTLTAARA TRPTTSTDQQ TTGSATSTRS       180
     NNRPMSAPNS KPGSRSSTPT RRPSTPNGSS TVLRSKPTKP LSKPALSLEA SPIVRSRPWE       240
     PYEMPGFSVE APSNLRTTLP DRPQTASSSR TRAFDASSSS RSASTERDVA KRQSCSPSRS       300
     RAPNGNVNGA VPSLRGQRAK TNNDDGRLIS HAAKGNQKVE KVVNMRKLAT PRLTESGSRR       360
     LGGGGGDSSA GKSSSGSGGF GFGRNLSKSS IDMALRHMVR                             400
//

If you have problems or comments...

PBIL Back to PBIL home page