(data stored in ACNUC13479 zone)

EMBL: CP002688.PE55

CP002688.PE55        Location/Qualifiers
FT   CDS             join(117520..117618,117742..117859,117933..118084,
FT                   118160..118243,118330..118392,118522..118656,
FT                   118749..118955,119355..119474,119697..119746,
FT                   119877..120039,120120..120260,120426..120533,
FT                   120615..120713,120864..121172,121267..121392)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.2"
FT                   /locus_tag="AT5G01290"
FT                   /product="mRNA capping enzyme family protein"
FT                   /note="mRNA capping enzyme family protein; FUNCTIONS IN:
FT                   phosphatase activity, protein tyrosine phosphatase
FT                   activity, protein tyrosine/serine/threonine phosphatase
FT                   activity, mRNA guanylyltransferase activity, polynucleotide
FT                   5'-phosphatase activity; INVOLVED IN: protein amino acid
FT                   dephosphorylation, mRNA processing, mRNA capping,
FT                   dephosphorylation; LOCATED IN: nucleus; EXPRESSED IN: 24
FT                   plant structures; EXPRESSED DURING: 15 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Nucleic acid-binding, OB-fold
FT                   (InterPro:IPR012340), Dual-specific/protein-tyrosine
FT                   phosphatase, conserved region (InterPro:IPR000387), mRNA
FT                   capping enzyme (InterPro:IPR001339), mRNA capping enzyme,
FT                   bifunctional (InterPro:IPR017074), Protein-tyrosine
FT                   phosphatase, active site (InterPro:IPR016130), Nucleic
FT                   acid-binding, OB-fold-like (InterPro:IPR016027), Dual
FT                   specificity phosphatase, catalytic domain
FT                   (InterPro:IPR000340), mRNA capping enzyme, C-terminal
FT                   (InterPro:IPR013846); BEST Arabidopsis thaliana protein
FT                   match is: mRNA capping enzyme family protein
FT                   (TAIR:AT3G09100.2); Has 888 Blast hits to 860 proteins in
FT                   246 species: Archae - 0; Bacteria - 2; Metazoa - 276; Fungi
FT                   - 241; Plants - 79; Viruses - 71; Other Eukaryotes - 219
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01290"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01290.1"
FT                   /db_xref="GOA:Q8GSD7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017074"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GSD7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:Z17627.1,INSD:AV798196.1,INSD:BP563844.1,
FT                   INSD:DR355246.1,INSD:BP591967.1,INSD:BP588577.1,
FT                   INSD:AV786438.1,INSD:EL171779.1,INSD:BP797965.1,
FT                   INSD:BP834070.1,INSD:BP824094.1,INSD:EH939563.1,
FT                   INSD:BP568835.1,INSD:EL131410.1,INSD:BP571238.1,
FT                   INSD:BP586097.1,INSD:AV822021.1,INSD:BP616965.1,
FT                   INSD:BP833437.1,INSD:BE526500.1,INSD:BP612120.1,
FT                   INSD:AV782639.1,INSD:BP575137.1,INSD:ES160931.1,
FT                   INSD:AV824508.1,INSD:BP565862.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT000440.1,INSD:BT001162.1"
FT                   /protein_id="AED90323.1"
FT                   /translation="MDLNASPQPEEDDEPFKRRHEDRMESAVEIARREREERKKRMRFD
FT                   RPTRVSQPAFRDQYRDTRVYDQSKLPQGWLDCPGFGLEIGCIIPSKVPLSESYNEHVPP
FT                   GKRYSFKQVVRNQRINGRKLGLVIDLTNTTRYYPTLDLKKDGIKHVKIACRGRDAVPDN
FT                   VSVNTFVNEVLQFVLNQKHAKKYVLVHCTHGHNRTGFMIVHYLMRSMPTMNVTQALKLF
FT                   SDARPPGIYKPDYIDALYTFYHEIKPESVTCPPTPEWKRSAELDLNGEAVQDDDDDDSP
FT                   PDPVQEINQENVKMSNDDTLGDEIPHYQEEAYRQFCYKMLMMNVGGRGFMQFPGSHPVS
FT                   LDRESLQLLRQRYYYATWKADGTRYMMLLTIDGCYLIDRSFKFRRVQMRFPCKHSREGI
FT                   SDKVHHYTLLDGEMVIDTPTGEQGEARRRYLVYDMVAINGESVVERTFCERWNMFVREV
FT                   IGPRAAEKLRSHCYRYDLEPFAVRMKGFWLLSTVEKLLKNTIPSLSHEADGLIFQGWDD
FT                   PYVPRTHKGLLKWKYAEMNSVDFLYEMGEEEGRGFLFLHERGKKKLMEGYSVEFRDDSD
FT                   PSSYNGKIVECAWDKDKKVWFSMRIRVDKTTPNDINTARKVIKSINDNITEEVLLQEIR
FT                   EIIRLPMYADRIRNDSQAARRR"
     MDLNASPQPE EDDEPFKRRH EDRMESAVEI ARREREERKK RMRFDRPTRV SQPAFRDQYR        60
     DTRVYDQSKL PQGWLDCPGF GLEIGCIIPS KVPLSESYNE HVPPGKRYSF KQVVRNQRIN       120
     GRKLGLVIDL TNTTRYYPTL DLKKDGIKHV KIACRGRDAV PDNVSVNTFV NEVLQFVLNQ       180
     KHAKKYVLVH CTHGHNRTGF MIVHYLMRSM PTMNVTQALK LFSDARPPGI YKPDYIDALY       240
     TFYHEIKPES VTCPPTPEWK RSAELDLNGE AVQDDDDDDS PPDPVQEINQ ENVKMSNDDT       300
     LGDEIPHYQE EAYRQFCYKM LMMNVGGRGF MQFPGSHPVS LDRESLQLLR QRYYYATWKA       360
     DGTRYMMLLT IDGCYLIDRS FKFRRVQMRF PCKHSREGIS DKVHHYTLLD GEMVIDTPTG       420
     EQGEARRRYL VYDMVAINGE SVVERTFCER WNMFVREVIG PRAAEKLRSH CYRYDLEPFA       480
     VRMKGFWLLS TVEKLLKNTI PSLSHEADGL IFQGWDDPYV PRTHKGLLKW KYAEMNSVDF       540
     LYEMGEEEGR GFLFLHERGK KKLMEGYSVE FRDDSDPSSY NGKIVECAWD KDKKVWFSMR       600
     IRVDKTTPND INTARKVIKS INDNITEEVL LQEIREIIRL PMYADRIRND SQAARRR          657
//

If you have problems or comments...

PBIL Back to PBIL home page