(data stored in ACNUC13479 zone)

EMBL: CP002688.PE56

CP002688.PE56        Location/Qualifiers
FT   CDS             complement(join(121643..121717,121817..122111,
FT                   122330..122448))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.10"
FT                   /gene_synonym="T10O8_10"
FT                   /locus_tag="AT5G01300"
FT                   /product="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein"
FT                   /note="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein; FUNCTIONS IN: phosphatidylethanolamine
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 7 plant
FT                   structures; EXPRESSED DURING: LP.04 four leaves visible, 4
FT                   anthesis, 4 leaf senescence stage, petal differentiation
FT                   and expansion stage, LP.08 eight leaves visible; CONTAINS
FT                   InterPro DOMAIN/s: YbhB/YbcL (InterPro:IPR005247),
FT                   Phosphatidylethanolamine-binding protein PEBP
FT                   (InterPro:IPR008914); Has 1807 Blast hits to 1807 proteins
FT                   in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736;
FT                   Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes -
FT                   339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M042"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M042"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP825736.1,INSD:Z17627.1,INSD:AV798196.1,
FT                   INSD:BP563844.1,INSD:BP591967.1,INSD:BP588577.1,
FT                   INSD:AV786438.1,INSD:BP815018.1,INSD:BP568835.1,
FT                   INSD:Z17689.1,INSD:BP571238.1,INSD:BP823076.1,
FT                   INSD:BP616965.1,INSD:BP648514.1,INSD:BP612120.1,
FT                   INSD:AV782639.1,INSD:BP575137.1,INSD:ES160931.1,
FT                   INSD:AV824508.1,INSD:BP565862.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX833357.1,INSD:BX833686.1,INSD:BX833214.1,
FT                   INSD:AY065369.1,INSD:AY096477.1"
FT                   /protein_id="AED90324.1"
FT                   /translation="MSSEELRLVSPTIDNDGKLPRKYTMAGQGVKKDISPPLEWYNVPE
FT                   GTKTLALVVEDIDAPDPSGPLVPWTVWVVVDIPPEMKGLPEGYSGNEDQTTGIREGNND
FT                   HKIPGWRGPLLPSHGHRFQFKLFALDDKPKIGHTVTKERLLIAIEGHVLGEAILTCLA"
     MSSEELRLVS PTIDNDGKLP RKYTMAGQGV KKDISPPLEW YNVPEGTKTL ALVVEDIDAP        60
     DPSGPLVPWT VWVVVDIPPE MKGLPEGYSG NEDQTTGIRE GNNDHKIPGW RGPLLPSHGH       120
     RFQFKLFALD DKPKIGHTVT KERLLIAIEG HVLGEAILTC LA                          162
//

If you have problems or comments...

PBIL Back to PBIL home page