(data stored in ACNUC13479 zone)

EMBL: CP002688.PE57

CP002688.PE57        Location/Qualifiers
FT   CDS             complement(join(121643..121717,121817..122128))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.10"
FT                   /gene_synonym="T10O8_10"
FT                   /locus_tag="AT5G01300"
FT                   /product="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein"
FT                   /note="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein; FUNCTIONS IN: phosphatidylethanolamine
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 7 plant
FT                   structures; EXPRESSED DURING: LP.04 four leaves visible, 4
FT                   anthesis, 4 leaf senescence stage, petal differentiation
FT                   and expansion stage, LP.08 eight leaves visible; CONTAINS
FT                   InterPro DOMAIN/s: YbhB/YbcL (InterPro:IPR005247),
FT                   Phosphatidylethanolamine-binding protein PEBP
FT                   (InterPro:IPR008914); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01300"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01300.2"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B3H785"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP817557.1,INSD:BP568835.1,INSD:Z17627.1,
FT                   INSD:BP571238.1,INSD:BP586097.1,INSD:BP648514.1,
FT                   INSD:BP616965.1,INSD:BP819245.1,INSD:BP563844.1,
FT                   INSD:BP591967.1,INSD:BP588577.1,INSD:AV786438.1,
FT                   INSD:AV782639.1,INSD:BP575137.1,INSD:BP565862.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX833298.1"
FT                   /protein_id="AED90325.1"
FT                   /translation="MLIWCRYNVPEGTKTLALVVEDIDAPDPSGPLVPWTVWVVVDIPP
FT                   EMKGLPEGYSGNEDQTTGIREGNNDHKIPGWRGPLLPSHGHRFQFKLFALDDKPKIGHT
FT                   VTKERLLIAIEGHVLGEAILTCLA"
     MLIWCRYNVP EGTKTLALVV EDIDAPDPSG PLVPWTVWVV VDIPPEMKGL PEGYSGNEDQ        60
     TTGIREGNND HKIPGWRGPL LPSHGHRFQF KLFALDDKPK IGHTVTKERL LIAIEGHVLG       120
     EAILTCLA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page