(data stored in ACNUC13479 zone)

EMBL: CP002688.PE58

CP002688.PE58        Location/Qualifiers
FT   CDS             complement(join(121729..121737,121817..122111,
FT                   122330..122448))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.10"
FT                   /gene_synonym="T10O8_10"
FT                   /locus_tag="AT5G01300"
FT                   /product="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01300"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BD35"
FT                   /protein_id="ANM69512.1"
FT                   /translation="MSSEELRLVSPTIDNDGKLPRKYTMAGQGVKKDISPPLEWYNVPE
FT                   GTKTLALVVEDIDAPDPSGPLVPWTVWVVVDIPPEMKGLPEGYSGNEDQTTGIREGNND
FT                   HKIPGWRGPLLPSHGHRFQFKLFALDDKPKIGHTLF"
     MSSEELRLVS PTIDNDGKLP RKYTMAGQGV KKDISPPLEW YNVPEGTKTL ALVVEDIDAP        60
     DPSGPLVPWT VWVVVDIPPE MKGLPEGYSG NEDQTTGIRE GNNDHKIPGW RGPLLPSHGH       120
     RFQFKLFALD DKPKIGHTLF                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page